KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2517Help
Entry
YE2517            CDS       T00469                                 

Gene name
YedO
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YE2517 (YedO)
Enzymes [BR:yen01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     YE2517 (YedO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2712058..2713050)
Genome map
AA seq 330 aa AA seqDB search
MTLQHKLAQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPLALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTSQENYLTNGNRLLL
DLFNVEVVMCDGLHDPNQQLAELATRIEAQGFRPYVVPVGGSNAFGALGYVQCALEIAAQ
SAGNVTFSSVVVASGSAGTHAGLAVGLQQLLPQTELIGVTVSRKAEEQRPKVIHIQQELA
TSLGVTSGPADITLWDDYFAPQYGMPNEEGLAAIGLLARLEGILLDPVYTGKAMAGLLDG
LEQKKFRDDGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacataaactggcgcaatttccgcgcctggatttggtcggtaatgccacg
ccattagagaaactatctcgtctttctgactatttgggacgcgaaatctatattaaacgt
gatgatgtcacccccttggcacttggcggcaataagctgcgtaagctggagtttttagcg
gctgatgcgttgaggcaaggagcggatacactggtgaccgcaggggctatccaatctaat
catgtgcgccaaacagcggctgttgctgcaaaattgggcttacattgtgttgcgttactt
gagaatcctatcggtacctcacaggaaaattatttgaccaatggcaatcgattgctgttg
gatttatttaatgttgaggtggtgatgtgcgatggattacatgatccaaaccagcaattg
gctgagttggcaacccgcattgaggcgcagggatttcgcccttatgtggtgccggttggt
ggctctaatgcttttggggccttgggatatgtgcagtgcgcattggaaattgcagctcaa
tcggctggaaatgtcaccttcagctcggtggttgtggcttcgggcagtgcgggtacccat
gcggggttggctgttggtttacagcaactgttgccgcaaacggagctgattggtgtcaca
gtatcgcgcaaagcagaagaacagcgccctaaagttattcatattcaacaagaattagcg
acatcgctcggcgtgaccagcgggcctgcggatatcaccctatgggatgattattttgcg
ccgcaatatggtatgccaaatgaagaagggctggcggcaatcgggttattggcaaggctg
gaagggatattgctggatccggtttataccggcaaggcaatggctggtttacttgatggc
cttgagcagaaaaagtttcgcgatgatggccccattttgtttattcataccggcggcgca
cctgcattatttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system