KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2571Help
Entry
YE2571            CDS       T00469                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:yen00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YE2571 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    YE2571 (cheB)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     YE2571 (cheB)
Two-component system [BR:yen02022]
 CheA family
  CheA-CheYBV
   YE2571 (cheB)
Bacterial motility proteins [BR:yen02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    YE2571 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2765345..2766394)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAPDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIAEKIRTAAKARLPQRGPEHAPVMLTHTPLLSSEKLIAIGASTGGTEAIRTVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TIAQNEASCVVFGMPREAIGMGGVNEILDLNQISQRMLAQISSGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgcgttgatgattccgcgttaatgcgccagttaatgaca
gagattattaacagtcacccagacatggaaatggttgcagcagcacctgatccgttggtt
gcccgtgatttgattaaaaaatttaatccgcaggtattaacactcgatgttgaaatgcca
cggatggatggtttggattttcttgagaaattaatgcggttacggccgatgccggtagtg
atggtttcatcattaaccggaaaaaactcagagataaccatgcgcgcgctggaattgggg
gctatcgattttgtcaccaaaccgcagttgggtatccgagaagggatgctggcttacagc
gagttgattgcggagaaaatccgcacggccgcgaaagctcgtttgccacagcgcggcccg
gaacatgcaccggtgatgctgacgcatacgccgttgctcagcagtgagaaactcattgcg
atcggcgcatcgacggggggaactgaagccatccgtaccgtgttacaacctttgcctccg
accagtccggcattgttgataacacagcatatgccaccgggttttacccgttcatttgca
gagcggctcaataaattatgccaaattaccgtgaaggaagcagaagacggtgagcgggta
ttgcccggacacgcctatattgcacccggtgatcggcacatggaattggcgcgcagtggg
gcaaactatcaggtgcgtattcatgatgggcctgcggttaatcgccatcgtccctcggtt
gatgtgcttttccgttcagtggcgcagtatgccgggcgcaatgcggtcggtgtcattctg
acgggaatgggtaatgacggtgctgccggcttactggagatgcatcgggcaggggcttat
accattgcacaaaacgaagccagttgtgtggtcttcgggatgccgcgtgaagctattggg
atgggcggcgttaatgaaatcttggatttgaaccagataagtcagcgcatgttggcacag
ataagcagtggtcaagccctgcgaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system