KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2766Help
Entry
YE2766            CDS       T00469                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00340  Histidine metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01230  Biosynthesis of amino acids
Module
yen_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    YE2766 (hisD)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     YE2766 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh SIP YjbH
Motif
Other DBs
NCBI-GeneID: 4716061
NCBI-ProteinID: YP_001006957
UniProt: A1JTV8
Position
3002595..3003920
Genome map
AA seq 441 aa AA seqDB search
MQPTNFNTLIDWQQCSEEQQKALLSRPAINASERITATVSEILDRVKAEGDSALRDFSQR
FDTVQVADIRISSDEIAAAAGRLNDDIKQAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLLSTVLMLGTPARIAGCQRVILCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVNKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIASDLLSQAEHGPDSQVVLLTPDAAIAQAVAVEVEQQLKQLSRADI
ARQALESSRLIITKDLQQCIDISNQYGPEHLILQIRQPEDIIDKIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVAALTAAQKEQA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctaatcgactggcagcaatgcagcgaagagcagcaa
aaagcgctgttgagccgcccggctattaatgcttctgagcgaatcaccgcaacagtcagt
gaaatccttgaccgggtgaaagccgagggcgacagcgccttgcgtgattttagccaacgc
tttgataccgtgcaggtggctgatattcgcatcagtagcgatgaaatagccgctgctgcc
gggcgcttgaatgacgacatcaagcaagctatggcgcaagcggtacgtaatattgaaatc
ttccacaacgcgcagaaaatgccagtggtggatgttgaaactcaaccgggcgtgcgttgc
cagcaaatcacccgcccgattgcttccgtcggcctgtatatccccggcggttctgctccg
ctactgtctaccgtgttgatgctcggcaccccagcgcgcattgccggttgccagcgcgtt
attttatgttctcctccgcctattgctgatgaaattctgtatgccgcgcaattgtgcggt
attcaggaagtgttccaaattggcggagcgcaggcgattgctgcaatggcatttggcagc
gaatcagtgccgaaagtgaataaaatctttgggccgggtaatgcttacgtcacagaagca
aaacgtcaggtcagccaacgtttggacggtgccgcgatagatatgccagcgggcccatct
gaagtattggttatcgctgacagcggcgcgacaccggcgtttatcgcctcagacttgctg
tctcaagccgagcacggcccagactcacaagtggtattactgacaccagatgccgcgatt
gctcaggccgttgcggtcgaagttgagcaacaacttaagcagttgtcgcgcgctgacatt
gcccgacaggcactggaaagtagccgtttgatcatcaccaaagatttgcagcaatgtatt
gatatcagtaatcaatacgggccagagcacttgattctgcaaatacgccagccggaagat
attatcgataagattgataatgccggctcagtgtttatgggtgactggtcgccagaatct
gcgggtgactatgcctctggcaccaatcacgtattaccgacttatggttacacctcaacc
tattccagtttgggactggctgattttgttaagcgtatgaccgtgcagcaattaaccccg
caaggcttgctgggtctggcatcaaccatcgaaacgctggctcaggctgaacaactgacc
gcccacaaaaacgccgttaccctacgcgtcgctgccctgacagccgcccaaaaggagcaa
gcatga

DBGET integrated database retrieval system