KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2777Help
Entry
YE2777            CDS       T00469                                 

Gene name
galF
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00040  Pentose and glucuronate interconversions
yen00052  Galactose metabolism
yen00500  Starch and sucrose metabolism
yen00520  Amino sugar and nucleotide sugar metabolism
yen01100  Metabolic pathways
yen01130  Biosynthesis of antibiotics
Module
yen_M00362  Nucleotide sugar biosynthesis, prokaryotes
yen_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YE2777 (galF)
   00052 Galactose metabolism
    YE2777 (galF)
   00500 Starch and sucrose metabolism
    YE2777 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    YE2777 (galF)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YE2777 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 4712433
NCBI-ProteinID: YP_001006967
UniProt: A1JTW8
Position
complement(3013002..3013895)
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYVVNECVAAGIKEIILITHSSK
NAVENHFDTSYELEAMLEARVKRQLLDEVQSICPPGVTIMHIRQGHAEGLGHAVLCAKPL
VGNEPFAVLLPDVLIDDAKSDLTKDNLAQLVKRFDETGVSQVLVHSVEPEALSNYSVISC
EKSDLAPGESSRIKAMVEKPQSPVDLQSNLSAVGRYVLSADIWPLLEQTKPGAWGRIQLT
DAIDALTEKAPVDAVALTGQSYNCGEKLGYMQAYVAYGLRHPQQGAEFKAWLKEFMA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgaaagcagtcattccagtggcaggtttaggcatgagaatgctgccagcg
acgaaagccattccgaaagaaatgctgccaattgttgataagccactaatccaatatgtg
gttaacgaatgtgttgctgctggcatcaaagaaatcattttgataacccattcatccaag
aatgcggtagaaaaccatttcgacacctcttatgaactggaagccatgttggaggcgcga
gtgaagcgccagctattggatgaagtgcaatctatctgccccccgggtgtgactattatg
catattcgccaggggcatgctgaaggattgggccatgctgtgctatgcgccaaaccactg
gtgggtaatgagccatttgcagtgttgttgccggatgtattgattgatgatgccaaatca
gatctgactaaggataatttggctcaattggttaaacgctttgatgaaaccggtgtcagt
caggtattggtacactcggtcgagccagaggcattatctaactactcggtgatttcctgc
gaaaaatccgatttggcaccgggtgaaagtagccgtattaaagccatggtcgagaagcca
caaagcccagttgacctacagtcaaacctgtctgccgttgggcgctatgttctgtctgct
gatatttggccactgttggaacaaaccaagccaggtgcctggggccgaattcaactgact
gatgctattgatgcattgacggagaaagcgccagtggatgctgtagccttgaccgggcaa
tcctataactgtggtgagaaactcggttatatgcaggcgtatgtcgcttatggcctgcgc
catccgcaacaaggtgcagagtttaaagcttggttgaaagaatttatggcctaa

DBGET integrated database retrieval system