KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2778Help
Entry
YE2778            CDS       T00469                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YE2778 (galU)
   00052 Galactose metabolism
    YE2778 (galU)
   00500 Starch and sucrose metabolism
    YE2778 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    YE2778 (galU)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YE2778 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3013961..3014842)
Genome map
AA seq 293 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGVKEIVLVSHSSKNAI
ENHFDTSFELEAALESRVKRQLLKEIKSICPPDVTIMQVRQGHAKGLGHAVLCAQPMVGD
NPFIVLLPDVLLDDSTADLSKENLASMIKRFEETGRSQIMVEPVPQADVSKYGIADCGHV
DLAPGESTLMTAVVEKPSVEEAPSNLAVVGRYVLSKDIWPLLKKTPRGAGDEIQLTDAIA
MLMEQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHNTEGENFTAWLKQQID
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtcattcctgttgccgggcttggcacccgtatgttgccagcgaccaaggcg
attccgaaagaaatgctgccagtagtcgataagcccctgattcaatatattgttaatgaa
tgtgttgctgccggggtcaaagagatcgtactggtgagccactcttccaagaacgcaata
gaaaaccattttgatacttcatttgaacttgaagcggccttggagtctcgggttaagcgg
cagttattaaaagagattaagagtatttgcccgccagatgtcactatcatgcaagtgcgt
caaggtcacgccaaagggttagggcatgcggtactctgtgctcagccgatggtgggtgat
aatccctttattgtattgctgccagatgtattactcgatgattcaaccgccgatttgtcg
aaagagaatcttgccagcatgatcaaacgttttgaggaaaccgggcgtagccagatcatg
gtggaaccggtacctcaagctgatgtttctaaatacggtattgctgattgcggccatgtc
gatttagcgccgggtgaaagtactcttatgactgcggtggtagagaagccttctgtagag
gaagctccgtctaatcttgctgtggtggggcgctacgttttgtctaaagatatttggccg
ttgctgaagaaaactccgcgtggtgctggtgatgaaattcaattgactgatgccatcgcg
atgttaatggaacaagaaccggttgaagctttccatatgaccggtaaatctcacgattgc
ggtgacaaattaggctatatgaaagcctttgtgacttatggtgttcgtcataatactgaa
ggtgaaaattttacagcttggctgaaacagcaaattgactaa

DBGET integrated database retrieval system