KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2818Help
Entry
YE2818            CDS       T00469                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE2818 (folE)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YE2818 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3062705..3063367)
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHEALLARGLETPLRKQELDAETRKTRIQEHMTQVMQLLNLDLSDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctgagtaaagaagctgagctggttcatgaagcactgctggcccgtggtctt
gaaaccccattgcgcaaacaagaattagatgccgaaacgcgcaagacccggattcaggaa
catatgacgcaagttatgcaattgctgaatcttgatttgtctgacgatagcctggccgat
acgccaagacgtattgctaagatgtatgttgatgagattttctctggactggattacgag
aatttccctaaaattaccctgatcgaaaataaaatgaaggtcgatgaaatggtaacggtg
cgagatatcaccctgaccagtacttgtgaacatcattttgtgactatcgatggtaaagcg
acagtggcctatatcccgaaagacagtgtgattggtttatccaaaattaaccgtatcgtg
cagtttttcgcccagcggccacaagtacaagagcgactgacacagcaaattctgttggcg
ttgcagaccttgttagggacaaataatgtcgctgtctccatcgatgcagtacattattgt
gtgaaagctcgcgggatccgcgatgcgaccagtgcgaccaccactacatcattgggcggg
ttgttcaaatccagccagaatactcgtcaggagtttctgcgtgctgttcgtcacaacggc
taa

DBGET integrated database retrieval system