KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2920Help
Entry
YE2920            CDS       T00469                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yen00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:yen00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3175030..3176094
Genome map
AA seq 354 aa AA seqDB search
MLKNDAASSSSVDQLAPDGHPFELTELHNKTGMSVTLMDWGATWLSAILPLKGGEKRELL
LGCQTPADYLHQAAYLGATVGRYANRIAKAQITVEGEILHLIPNQGENQLHGGPEGFHNR
RWKKVKQDEKQVTYQLHSPDGDQGFPGNLTAEVQYLLTEDNRLEIHYQAQVDKTCPVNLT
NHAYFNLDGEGRDVRAHRLQLFADRYLPVGSDGIPTAGLESVEKTGMDFRQAKTLARDFL
QDRGQQRVKGYDHAYLLHRTCGATESPAAHLWSSDNQVQMSVYTTAPALQLYSGNFLGGT
PARNGGTYASYTGVALESEFLPDSPNHPEWPQPDCWLKPGKTYHATTVYHFIAL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaacgacgctgcatcatcaagcagtgttgaccagttagcaccggatggtcac
ccctttgaattgaccgagttacataataaaaccggcatgagcgtgacgctgatggattgg
ggcgctacctggttatcagcaatattgccactaaaagggggcgaaaaacgtgagttgctg
ctgggctgccaaaccccggccgattatctgcatcaagcggcttatctcggtgcgacagtt
ggccgctacgccaaccgcattgcgaaggcacaaatcaccgtagagggcgaaatcctccat
ctgatacccaatcaaggcgagaaccaactacatggtggcccggaagggttccataaccgg
cgctggaaaaaggttaagcaagatgagaagcaggtcacttatcagttgcactctcctgat
ggtgatcagggtttccctggtaatctaaccgccgaagtgcagtatctgctgaccgaggat
aatcggctggagattcactatcaggctcaggttgataaaacctgcccggtaaacctgacc
aatcatgcgtactttaatctcgatggcgaaggacgagacgtgcgggcgcatcgattacag
ctgtttgctgaccgctatttaccggtcggcagtgatgggatacccaccgctggactcgaa
agtgttgaaaaaactggcatggatttccgtcaagcgaaaacactggcgcgcgacttcctg
caagaccgtggtcaacaacgggtgaaaggttatgaccatgcctatctgctacatcgcact
tgtggtgctaccgaaagcccggcggcgcacctgtggtcttctgataatcaagttcaaatg
agcgtatacaccacagcacccgcattgcagctctatagcggtaatttcctcggcggaaca
cctgcgcgtaatggcggaacctatgccagctatactggcgtcgctttggaaagtgaattc
ttacctgatagccctaaccacccggaatggccacaacctgattgttggctaaaaccgggg
aaaacctaccatgcaaccaccgtttatcactttatcgcgttatag

DBGET integrated database retrieval system