KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2924Help
Entry
YE2924            CDS       T00469                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE2924 (gpmA)
   01230 Biosynthesis of amino acids
    YE2924 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE2924 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YE2924 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE2924 (gpmA)
Enzymes [BR:yen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YE2924 (gpmA)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YE2924 (gpmA)
  Exosomal proteins of melanoma cells
   YE2924 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3179811..3180563
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWSILDELDQAWLPTEKTWKLNERHYGALQGLDKSETAAKYGDEQVKLWRRGFA
ITPPALDKSDERFPGHDPRYAKLTDAELPTTESLALTIDRVIPYWEEVIKPRIASGERVI
IAAHGNSLRALVKYLDNLNEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaagctggttctggtacgtcacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgacgttgatttgtctgagaaaggccgtaccgaagcaaaagca
gctggcaagctgttgaaagatgaaggttttacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggagcatcctggacgaattggatcaggcttggcttcca
acggaaaaaacctggaaactgaatgagcgtcattacggcgcattgcaaggtttggataaa
tctgaaactgcggctaaatacggtgatgagcaagttaaactgtggcgtcgcggctttgcc
atcacccctccagcactggataaaagtgatgagcgcttccctggtcatgacccacgttat
gcaaaattaaccgatgcagaactgccaaccactgaaagcctggctctgactatcgatcgc
gttatcccttactgggaagaagtgatcaaaccacgcatcgccagtggcgagcgcgttatc
atcgctgctcacggtaactctttgcgtgcactggtgaaatatctggataatctgaacgaa
gaagaaattcttgagctgaatatcccaacaggtgtgccattagtgtatgagtttgacgaa
aacttcaaaccaatcaaacactactatttgggcaacgctgatgaaatcgcggctaaagct
gctgcggtggccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system