KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2974Help
Entry
YE2974            CDS       T00469                                 

Gene name
chb
Definition
chitobiase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YE2974 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YE2974 (chb)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YE2974 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3237040..3239715)
Genome map
AA seq 891 aa AA seqDB search
MNKFRLNALAAITATFGLMGAAHADATNQQIVDQLSALTVNYKVLDNRAAENGVDCAKLG
ADWASCNKVLITLTNTGDEIKGQDWAIYFHSIRQILTVDNDQFKITHLTGDLHKIEPTAK
FTGFPANQAVEIPITGEYWQLFATDFMPRWYATSGDAKPKVLKSTDTEDINEYLTQFTGD
QWKRTKDDNNVLMTPESRFVKNEAVKTLTAANLRGQIIPTPMEVKVHQQDADLSQGVALD
LSTLPKPAAEAAAQRFALLGLKLGATGFPIKTVIQPSAFKGDLAVSGAYELKIGEKGAQV
IGFDPTGVFYGLQSILSLVATDGSKKIATLDAKDAPRFEYRGVFLDVGRNFKTKDAVLRL
LDQMAAYKLNKFHFHLSDDEGWRIEIPGLPELTDVGSKRCHDLTENTCLLPQLGSGPDSN
NLGSGHFTRDDYIDILKYAKARQIEVIPEIDMPAHARAAVVSMEARYNNLMKQGKEKEAN
EFRLVDPTDDSNTTSVQFYERKSYLNPCLDSSKRFVGKVIGEMAQMHKEAGMPLNTWHFG
GDEAKNIRLGAGFQDKNGPIEPGKGIIDKSIEDKPWAKSQVCQDMVKQGKIQDVEHLSSH
FAIEVSKLVNAHGIEKMQAWQDGLKDAKSSKDFATKRVGVNFWDTLYWGGADSINDWANK
GYEVVASNPDYVYFDMPYEVNPNERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGN
HFSAKSDKPWPGVHGISGQSWNETVRTDEQMEYMIFPRVLPLAERAWHRASWEQDYKAGR
EYQGGVTHRVDTKALNSDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVGGELEANIS
LPGLIIEYSTDGGKQWQQYDAKAQPKVSGDVLIRSTSPDGKRSSRAEPVKV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcagattaaatgcgttagcggcaatcaccgcaacctttggcttgatgggc
gctgcccatgcagatgccaccaatcaacagattgttgatcaactcagcgctttgacagtt
aattataaagtgttggataaccgcgcggctgaaaatggcgtagattgtgccaagttggga
gctgactgggcatcatgcaataaggtattgattactctgaccaacactggggatgagatc
aaaggccaggactgggccatttacttccatagtattcgtcaaattctcaccgtagataat
gatcagtttaaaattactcacctgacgggtgatctacataaaattgaacctaccgccaaa
tttactggtttccctgccaatcaggcggttgaaatcccgatcaccggcgaatactggcag
ttatttgccaccgactttatgccgcgctggtatgccacttcgggtgatgcaaaaccaaaa
gttctgaaaagtactgatactgaagatattaatgaatatctgactcagtttacgggcgat
cagtggaagcgcactaaagacgacaataacgtattaatgacaccggaatctcgcttcgtc
aaaaatgaggccgtgaaaacattaacggcagctaacctacgcgggcagattatcccgaca
ccaatggaagtgaaggttcaccaacaagatgccgatttgagtcaaggtgtggcgcttgac
ctgagcactttgcccaaaccggctgctgaggcggcggcgcagcgttttgcattacttggc
ttgaagttgggtgcaacggggttcccgattaaaacggtgattcaaccctctgcctttaaa
ggtgacttagccgtttcaggggcatatgagctgaaaatcggtgaaaagggcgcgcaagtg
attggttttgacccaacaggtgtgttttacggcctgcaatccattctttctttagtagcg
actgatggtagcaagaagattgcgacattggatgccaaagatgcgccacgctttgaatac
cgtggtgttttcctggatgtagggcgtaacttcaaaactaaagatgcagtattgcgtttg
cttgatcagatggccgcttacaagctgaacaaattccacttccatctgagtgatgatgaa
ggctggcgtattgagataccaggcttgccagaactgaccgatgtgggcagcaagcgttgc
cacgatttaacggaaaacacctgcttactgccgcaattgggctcaggcccggatagcaat
aatttgggctcgggtcactttacccgtgatgattacatcgacattttgaaatatgcgaaa
gcccgccaaattgaggtcattcctgagattgatatgcccgcccacgcgcgtgcagccgtc
gtctcgatggaagctcgttacaacaatttgatgaagcagggtaaggaaaaagaagccaac
gagttccgcctggttgacccgacagatgattccaacacgacttctgttcagttctatgaa
cgcaaaagttatctcaacccatgtctggattcgtctaaacgctttgtcggcaaagtgatt
ggcgaaatggctcaaatgcacaaagaagcgggtatgccgctgaacacttggcattttggc
ggtgatgaggcgaaaaatatccgcctgggcgcgggcttccaggacaaaaatggcccgatt
gagccgggtaaaggcattattgataagagtattgaagataagccgtgggccaaatcacaa
gtttgccaggatatggtcaagcaagggaaaattcaggatgttgagcacctttccagtcac
tttgctattgaagtcagcaagctggtgaatgcccatggcattgaaaaaatgcaagcctgg
caagacggccttaaagatgccaagtcgtcgaaagactttgccacgaaacgggtgggcgtt
aacttctgggataccctctattggggtggtgccgattcaatcaatgattgggccaataaa
ggctatgaagtggtcgcgtcgaatccggattatgtctatttcgacatgccatatgaagtt
aacccaaatgagcgcggttattactgggcgactcgcttcagcgacgaagctaaagtcttt
agtttcgcgccggataacatgccacaaaacgcggaaacatcggtcgaccgtgacggtaat
catttcagtgctaaaagtgataaaccttggccgggtgtgcacggtatttccggtcaatca
tggaatgaaacagtacgaactgatgaacaaatggaatacatgattttccctcgagtatta
ccactggccgaacgtgcctggcatcgtgcgtcttgggagcaggattataaagccggtcgt
gagtaccaaggtggcgtaacgcatagggttgacaccaaggcgttgaactcagattggcag
cgttttgccaatattatgggccaacgtgaattggcgaaactggataaagccggagtggct
tatcgcttgccagttccaggggcgcgagttgttggcggggaattggaagctaatatctcc
ttaccgggtctgattatcgagtattccactgatggcggaaaacaatggcagcagtatgat
gccaaagcacaaccgaaagtcagtggcgacgtattgattcgttccaccagcccggatggt
aaacgtagtagtcgtgcggagccggttaaggtttga

DBGET integrated database retrieval system