KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2983Help
Entry
YE2983            CDS       T00469                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE2983 (asnB)
Enzymes [BR:yen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YE2983 (asnB)
Peptidases [BR:yen01002]
 Cysteine Peptidases
  Family C44
   YE2983 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3251009..3252673
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLFNAAHTHILAVNGEIYNHQALRQQYGDRYKFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDFDNVKNNVTDKVELANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDDERSEAWWPQLHSFAVGLMGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPSSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKSMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcctcgaccttaaaactgaccccattgagttacgcaaaaaa
gcgctggaaatgtcacgtctaatgcgccaccgcggcccggactggtcaggtgtatgggca
aatgataaagccatactcgcccatgaacgcttatctattgttgacgtcaatactggtgcc
cagcccctgtttaacgcggcgcacacacatattctggcggtcaatggtgaaatttataat
catcaggcattacgccagcaatacggcgaccgttataaattccagaccggttctgactgt
gaagtcattctggcgctgtatcaggagaaagggcctgaattccttgacgacctgcaaggt
atgttcgctttcgtcctatacgatacggaaaaagacgcttacctgattgggcgtgaccat
ctgggtattatcccgctgtacatgggccacgacgaacacggtaatatgtttgtggcttca
gaaatgaaagccttggttccggtttgccgtaccatcaaagaattcccggccggaagctat
ctgtggagtcaggatggcgaaattcgcgagtattatcatcgcgactggtttgatttcgat
aatgtcaaaaacaatgtcactgataaagttgaactggcaaatgcgttagaagatgcggtt
aaaagtcatttgatgtccgacgttccttacggcgtgctgctctctggcggtctggattcc
tcggttatttcggctatcaccaaaaaatttgcggctcgtcgcgtagaagatgatgaacgc
agtgaagcctggtggccacaattgcactccttcgccgtaggtttgatgggttcaccggat
ttgcgcgccgcgcaagaggtcgccaaccatttgggtaccgtgcatcatgaaattcacttc
accgtgcaggaaggtctggatgccatccgtgatgtgatttatcacattgaaacttatgat
gtcaccactatccgcgcctcaacaccaatgtacttgatgtcacgtaaaatcaaggcgatg
ggtatcaaaatggtgctatctggcgaaggttctgacgaagtatttggcggttacctctat
ttccacaaagcgccaaatgccaaagagttacatgaagaaaccgtgcgcaagctgttagcc
ctgcatatgtatgactgcgctcgtgccaacaaagcgatgtctgcctggggtgttgaagcg
cgtgtaccattcctggataaaaacttccttgatgtggcgatgcgaattaacccgcaggat
aaaatgtgcggtaatggcaaaatggaaaaacatgtactacgtgaatgttttgaatcctac
ctgccacatagcgtcgcatggcgtcagaaagaacaattctccgatggtgtgggttacagc
tggattgatacattaaaagagaaagctgccgagcaagtcactgatcaacagatggaaact
gcgcacttccgtttcccatacaacacgccgtcctccaaagagggctacttgtatcgagaa
atttttgaagagctattcccactgccaagtgcagcggaatgcgtgcctggcggcccttca
gtagcatgttcatcagctaaagctattgaatgggatgaatcattcaaaagcatggatgac
ccttctggtcgcgcggtaggtgtgcatcaggatgcttacaaataa

DBGET integrated database retrieval system