KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3055Help
Entry
YE3055            CDS       T00469                                 

Gene name
apeA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YE3055 (apeA)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YE3055 (apeA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YE3055 (apeA)
Lipid biosynthesis proteins [BR:yen01004]
 Fatty acid synthase
  Component type
   YE3055 (apeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3321216..3321854
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAEAWPSRLDKTWQA
TPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDGLRGFPPQDIQRDLTQ
VINLIKEAKAQPLLMQIRIPPNYGRRYTDAFSAMYPQLAQQFGIPLVPFFMEQVAVKPEW
MQDDGLHPNAQAQPFIADWMAQQLKPLVTNKS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaatgttttccgctggcatcttcccttcctattactattgggatta
ttcagtttgcgtgccgccgcaaccgatacacttttaattctcggcgacagtttaagcgcc
ggttaccgcctgccgattgccgaagcctggccttcacggctggataaaacatggcaggcc
accccatcattacccaaggtggttaacgccagtatcagtggtgatacggcggcccagggc
ttagcccgtctgcctgccttgctgaaacaacatcagccccgctgggtactgattgaatta
ggtgccaatgacggcctgcgcggtttcccaccgcaggatattcaacgggatctcacgcaa
gttatcaatctgataaaagaagcaaaagcgcaacctttgttgatgcaaatccgcattcca
cctaactacggccgccgttatactgatgccttcagtgcgatgtatccacaactggcacag
caatttggcatcccattggtacccttttttatggaacaggttgctgtgaagccagagtgg
atgcaggatgatgggttacatcctaacgcacaggcgcaacctttcattgcagattggatg
gcgcaacaacttaaaccgttagtaaccaataagtcttag

DBGET integrated database retrieval system