KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3055Help
Entry
YE3055            CDS       T00469                                 

Gene name
apeA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:yen01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3321216..3321854
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAEAWPSRLDKTWQA
TPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDGLRGFPPQDIQRDLTQ
VINLIKEAKAQPLLMQIRIPPNYGRRYTDAFSAMYPQLAQQFGIPLVPFFMEQVAVKPEW
MQDDGLHPNAQAQPFIADWMAQQLKPLVTNKS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaatgttttccgctggcatcttcccttcctattactattgggatta
ttcagtttgcgtgccgccgcaaccgatacacttttaattctcggcgacagtttaagcgcc
ggttaccgcctgccgattgccgaagcctggccttcacggctggataaaacatggcaggcc
accccatcattacccaaggtggttaacgccagtatcagtggtgatacggcggcccagggc
ttagcccgtctgcctgccttgctgaaacaacatcagccccgctgggtactgattgaatta
ggtgccaatgacggcctgcgcggtttcccaccgcaggatattcaacgggatctcacgcaa
gttatcaatctgataaaagaagcaaaagcgcaacctttgttgatgcaaatccgcattcca
cctaactacggccgccgttatactgatgccttcagtgcgatgtatccacaactggcacag
caatttggcatcccattggtacccttttttatggaacaggttgctgtgaagccagagtgg
atgcaggatgatgggttacatcctaacgcacaggcgcaacctttcattgcagattggatg
gcgcaacaacttaaaccgttagtaaccaataagtcttag

DBGET integrated database retrieval system