KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3091Help
Entry
YE3091            CDS       T00469                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yen03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3362773..3363378)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEHCTICSNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLETETISEVILATNPTVEGDATANYIGQMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccactccttgaatcattgatggaggcgttgcgttgcttgccgggcgtt
ggcccgaaatcggcgcaacgtatggcatttcaattgctacagcgggatcgtagcggtgga
atgcgcctggcacagtcattgacgcgcgcaatgtctgaaattggtcactgcgctgactgc
cgtacctttaccgagcaagagcattgcactatttgctctaatccgcggcggcaacaaaat
ggtcaaatctgcgtggtcgaaagcccggcagatattcatgccattgagcaaacgggccag
tttggcgggcgctactttgtgttgatggggcatttatctcccatggacggcataggcccc
ggtgatattggtttggatttgctggaaaaacggctggaaactgaaactatcagtgaagtc
attctggcgaccaacccgacagtcgaaggggatgcaaccgccaactatattggtcagatg
tgcggccagtatggtgtgttagccagccgtattgcacacggtgtgcccgttggcggtgag
ttggaaatggttgatggtaccaccctatcccactcattagcggggcgtaatcccattaag
tactag

DBGET integrated database retrieval system