KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3165Help
Entry
YE3165            CDS       T00469                                 

Gene name
yajC
Definition
preprotein translocase subunit YajC
Orthology
K03210  
preprotein translocase subunit YajC
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:yen00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    YE3165 (yajC)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    YE3165 (yajC)
Secretion system [BR:yen02044]
 Sec (secretion) system
  Bacterial Sec-SRP protein [MD:M00335]
   YE3165 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3438298..3438630)
Genome map
AA seq 110 aa AA seqDB search
MSLFISDAVASAGAPAQSSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGD
EVLTTGGLLGRVTKVAETGYIVIALNDTTEVMIKRDFVAAVLPKGTMKAL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttttcatttccgatgctgtcgcatccgctggggctccggctcaaagcagcccg
tactctctggtgattatgctggtggtatttggtctgattttttacttcatgatcttgcgt
ccacagcaaaaacgtgccaaagaacacaaaaaactgatggattctattggtaaaggtgat
gaagtgctgaccactggtggtttacttggtcgtgttactaaagttgcggaaactggttat
atcgttatcgcactgaacgacaccactgaagtgatgatcaaacgtgacttcgttgctgcc
gttttaccgaaaggtacaatgaaagctctgtaa

DBGET integrated database retrieval system