KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3280Help
Entry
YE3280            CDS       T00469                                 

Gene name
b0173
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00900  Terpenoid backbone biosynthesis
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YE3280 (b0173)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     YE3280 (b0173)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-GeneID: 4713374
NCBI-ProteinID: YP_001007454
UniProt: A1JP78
Position
complement(3581791..3582987)
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGNSTLGVVRANPELFKITALVAGRNVHQMAQQCLEFAPRYAAMSDET
SAKALRLILAENGSRTEVYSGEKAACELAAIDDVDQVMAAIVGVAGLPSTLAAIRAGKQV
LLANKESLITCGKLFMDEVMHSRAQLLPIDSEHNAIFQSLPEKVQSQLGYSSLSDNGVSR
IILTGSGGPLRETPLVQFADVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAEQVEVILHPQSVIHSMVRYHDGSVLAQMGTPDMRTPIAHAMAYPMRVNSGVAPLDFC
KIRELTFAEPDYQRYPCLKLAIDASNAGQAATTALNAANEISVMAFLDSRIRFTDIAVIN
RMVVEQLSLPEPASVDEVLVIDRKARDAAVQAIAKLNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgactattcttggttctacaggctccatcggcaacagcactctgggtgtt
gtgcgcgctaatcccgaattattcaaaatcaccgcattggttgctggtcgcaatgtccac
cagatggcgcaacaatgtctcgaatttgccccccgttatgcagctatgtccgatgaaacc
tcggctaaagcgttacgcctgatattggcagaaaatggttcacgaactgaggtttattcc
ggtgagaaagcggcgtgtgaactggcggcgatagacgatgtcgatcaggtaatggctgcg
attgtcggcgtcgcagggttgccttccacgctggcagctatccgtgcgggtaaacaagta
ttactggctaacaaagagtcgctgattacctgtggtaagctttttatggatgaagtgatg
cacagtcgtgcgcaattgctacccatcgacagcgaacataatgctatttttcagagttta
cctgaaaaggttcagtctcaattaggctattcttcactgagtgataatggtgtttcccgc
attatcttaacaggttctggtggcccactgcgcgaaacgccattagtgcaattcgcagat
gtcactccagaccaggcttgcgcgcatccaaactggtctatggggcgtaagatttcggtc
gactctgcgacaatgatgaacaaagggctagagtatatcgaggcgcgctggttatttaac
gctagcgcggaacaggtggaggttattttacatcctcaatctgtcattcattcgatggtg
cgctaccatgatggcagtgtattggcgcagatgggtaccccagatatgcggacacctatt
gcgcatgcgatggcgtacccaatgcgcgtgaattcaggcgttgcgccgctggatttctgc
aaaatacgcgagctgacttttgctgagccggattatcaacgttatccctgcctgaagctg
gctattgatgcttctaatgcaggtcaggccgcaaccacagcactgaatgccgccaatgaa
atttctgtcatggcatttttagattcgagaattcgtttcaccgacattgcagtcattaat
cgtatggttgtggagcagttatcattaccagagccagccagtgtagatgaggtattggtg
attgaccgtaaagcccgtgatgcagccgttcaagcaatagcaaaattgaataattaa

DBGET integrated database retrieval system