KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3440Help
Entry
YE3440            CDS       T00469                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE3440
   00330 Arginine and proline metabolism
    YE3440
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YE3440
Enzymes [BR:yen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YE3440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3752894..3753796)
Genome map
AA seq 300 aa AA seqDB search
MLADILQQVRPLIGQGKVADYIPALAEVSADKLGIAVCTLDGSIYQAGDANERFSIQSIS
KVLSLTLALSRYGEQEIWQRVGKEPSGQPFNSLVQLELEKGKPRNPFINPGALVVCDMLQ
SRLSAPKQRMLEVVRQLVNDDNISYDPRVARSEFEHSDRNAAIAYLMKSFGNFNNDVLTV
LQTYFHYCAMRMSCVELARCFVYLANQGRSISGHGSLITPMQARQINALMITSGMYDGAG
EFAFRVGMPGKSGVGGGIIAIVPDELCIAVWSPELDHAGNSLAGTAALELLAQRIGRSIF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgctggcggatatcttgcagcaggtacgcccgctgattggtcaagggaaagtggcggat
tatatccccgccttggccgaagtttcggctgacaaattgggtatcgcggtctgtacacta
gatggctcgatatatcaggccggagatgctaatgagcgcttttctattcaatcgatttca
aaagtattaagtttgacgctggcattatctcgttatggcgagcaggaaatatggcagcga
gtgggtaaagagccatcaggccagccatttaactctctggtgcagttagagttagaaaag
ggcaaaccgcgcaacccgtttattaatcctggggcgctggtggtgtgcgatatgctacaa
agccgcctaagtgctccgaagcaaaggatgttagaagtggtgcgtcagttagtgaatgac
gacaacattagctacgacccgcgagtggcgcgctcggaatttgagcattcagatcgcaat
gctgctattgcctatctaatgaagtcttttggtaatttcaacaacgatgttctgacagta
cttcagacctatttccactattgtgccatgcgcatgagttgtgtcgaactggctcgctgc
tttgtctatctggcaaatcaggggcgcagtattagtgggcatggctcgcttatcacaccc
atgcaagcgcggcaaatcaatgctctgatgattaccagcggtatgtatgatggagccggt
gaatttgccttccgcgtgggtatgccgggtaaatcgggggtcggaggcgggattatcgcc
attgtgcctgacgagttatgtattgcggtttggtcaccggaattagatcatgccgggaac
tctctggccggaacggctgccttagagctactggcacagcggattggccgctccattttt
tag

DBGET integrated database retrieval system