KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3880Help
Entry
YE3880            CDS       T00469                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00630  Glyoxylate and dicarboxylate metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01200  Carbon metabolism
Module
yen_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YE3880 (aceA)
Enzymes [BR:yen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YE3880 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-GeneID: 4714715
NCBI-ProteinID: YP_001008025
UniProt: A1JRX1
Position
complement(4234397..4235704)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSPRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPDSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcaccgcgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgcactttggcgcagcatggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggtggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatttgtcaggctggcaggtcgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttcccgca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccggatagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggggtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgccgcccgtctggct
gccgacgttctcggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgac
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagtcgcggcctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagctaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgag
ctgtcggcgatgggttacaaataccagtttattacactggcgggtatccacagcatgtgg
ttcaacatgttcgatctggcgcatgcttacgcacagggagaaggcatgaaacactatgtt
gagaaggttcagcagcccgaatttgccgctgttgagcgcggctacactttcgcgtcccat
caacaggaagtgggtaccggctactttgataaagtcaccaatatcattcagggtggtgag
tcttccgtaacagcattgactggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system