KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3880Help
Entry
YE3880            CDS       T00469                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE3880 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YE3880 (aceA)
Enzymes [BR:yen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YE3880 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4234397..4235704)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSPRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPDSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcaccgcgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgcactttggcgcagcatggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggtggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatttgtcaggctggcaggtcgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttcccgca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccggatagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggggtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgccgcccgtctggct
gccgacgttctcggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgac
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagtcgcggcctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagctaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgag
ctgtcggcgatgggttacaaataccagtttattacactggcgggtatccacagcatgtgg
ttcaacatgttcgatctggcgcatgcttacgcacagggagaaggcatgaaacactatgtt
gagaaggttcagcagcccgaatttgccgctgttgagcgcggctacactttcgcgtcccat
caacaggaagtgggtaccggctactttgataaagtcaccaatatcattcagggtggtgag
tcttccgtaacagcattgactggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system