KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3881Help
Entry
YE3881            CDS       T00469                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE3881 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YE3881 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    YE3881 (aceB)
Enzymes [BR:yen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YE3881 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4235877..4237475)
Genome map
AA seq 532 aa AA seqDB search
MTQQLVGTELVFTQHFNAAERQVLPEEAIEFLTELVVKFAQSRRELLAARVSWQKNIDQG
ALPDFISETNSIREGGWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYVNESGKIYQLKPNPAVLIARVRGLHLPEKHVKWQG
EDIPGGLFDFALYFYHNYKQLLANGSGPYFYLPKMQSYQEAAWWSDVFTFTEQRFDLPQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHGDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPNKDPVKNAQVLDKVRADKELEASNGH
DGTWVAHPGLADTVMEVFNKVLGDRPNQLEVSRAQDKPITAAELLEPCSGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKNLSNGQTVTKELFRN
MLSEEMQVVKLELGTERFDGGRFEEAACLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagttagtcggcacggagttagtttttacacagcattttaatgctgctgaa
agacaggttttaccggaagaagcgatcgaattcttgaccgaattggtggtgaaattcgca
cagtcacgtcgtgaactccttgccgcacgggtatcctggcaaaaaaatatcgatcaaggt
gccttaccggattttatttcggaaactaattccattcgtgaaggtggctggaagattcag
gggattcctgctgacttacgtgatcgtcgggtggaaattaccgggccggttgagcgaaaa
atggtgattaatgctctcaatgccaatgtaaaagtctttatggctgatttcgaagactcg
ttggcaccaagctgggacaaagtgatcgatggtcaaattaacctgcatgatgcggtaaaa
ggcactatttcctatgtaaatgaatccggcaagatttatcaactcaaacccaaccctgcg
gtactgattgcgcgagttcgcggcctgcacttgccggagaaacatgtgaaatggcagggg
gaagatattcctggtggactgttcgatttcgctttgtatttctatcataactataagcaa
ttacttgccaatggcagcggcccttatttttatttgccgaagatgcagtcttatcaggaa
gccgcttggtggagtgatgttttcacctttaccgagcagcgcttcgacttaccgcaaggc
accattaaagccacggtattaattgaaacattacctgccgtgttccaaatggatgaaatc
ctctatcacctgcgccatcacattgttggcctcaattgtggtcgttgggattatatattc
agctatatcaagacactgaaaaatcacggtgatcgtgtgttgccagaccgccaatcggtc
accatgaataaaccattcctgagtgcgtattcccgtttattgatcaaaacctgccataaa
cgcggtgctttagcgatggggggtatggcggcatttatcccgaataaagatccggtaaaa
aatgcgcaagtactggataaagtccgtgcggataaagagttagaagccagtaatggccat
gatggtacatgggtagcccatccagggctagccgataccgtgatggaagtctttaacaag
gttctgggtgaccggccaaatcaattagaggttagccgggcacaggataaacctataacc
gcagctgagttgttggagccttgcagtggtgaacgcacggaagaagggatgcgcgccaat
atccgggttgctgtgcaatacattgaagcatggatatctggcaatggttgcgtgccgatt
tatggcctgatggaagatgccgcgacggcagagatttcccgtacttctatctggcaatgg
atacatcaccagaaaaacctgagtaatggtcaaacggtgacgaaagagctgttccgaaac
atgttgagtgaagaaatgcaggtagtgaagctggaacttggcacagagcgctttgatggc
gggcggtttgaagaagctgcgtgtttgatggagcgaattacaacacaagacgagcttatc
gacttcctgaccttaccaggctacgcattacttgcctga

DBGET integrated database retrieval system