KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3992Help
Entry
YE3992            CDS       T00469                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YE3992 (malQ)
Enzymes [BR:yen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YE3992 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4342357..4344453
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAANYINAHGKSQAISAQTKQQLLAAMGRTSVPPDSQTEKAPLPPV
KIFTFGSAMQLPMAGSGDYHWQLQTEKGDLHQGRISAKKTLTLPASLPQGYHRLVLEQGL
QQWQCSVIVAPKRCYEPDALLAGKKLWGACVQLYTLRSDHNWGIGDFGDLNQMLEQVAER
GGAFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDVNRVDEFQHSEAAQTWWHQPEI
QGALAKARASEWVDYPQVMQLKLTALRLAFPLFTARKTKDARVQAFHRFVEQGGSSLHQQ
AAFDALHAHLSKNDPMMWGWPVWPEKYRDGHSSAVADFSREHADEVNFYLWLQWLAASQF
EDCFRASQTRKMPLGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMAARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGQTADQGAYVKYPV
DDLLAILALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENTFRAPQS
YPVQAMATITTHDLPTLRGYWQSDDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
HYDCVPTKVGHKASLLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMATPVNIPGTSDE
YPNWRRKLTATLEEMFADEQVNRLLKDLDKRRKNVSAG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcgacactggcagggattgccgccaattatatt
aatgcgcatggtaagtcgcaggctatttcagcacaaaccaagcagcagttattggcggcc
atgggacgcaccagtgtgcccccagattctcagacagaaaaagcaccattaccaccggta
aaaatatttacttttggcagcgcaatgcaactgccaatggcgggatcaggcgattatcac
tggcagttacagaccgaaaaaggtgatttgcatcaagggcgtatcagcgccaaaaaaacg
ctgacattgccggcctcactgccgcaaggctatcaccgcttggtattggaacaaggctta
cagcagtggcagtgctcggttatcgttgctccgaaacgttgctatgagccagatgccctg
ctggcagggaaaaaactctggggagcctgtgttcagttgtataccctgcgctccgatcat
aactggggtatcggtgattttggcgacctcaatcagatgttggagcaggtcgctgagcgc
ggtggggcctttattggtcttaacccgattcatgcactgtatccggccaacccacatagt
gccagcccttacagcccttcttcccggcgctggctgaatgtgatttatattgatgtcaat
cgcgtggatgaattccagcatagcgaggcggcgcagacctggtggcatcagcccgagata
caaggcgcgctggcgaaagcgcgtgccagtgaatgggttgattatccgcaggtcatgcag
ctcaagttgaccgctttgcgtttggctttcccactttttacggcgcgcaaaaccaaagat
gctcgggtacaggcattccaccgttttgttgaacagggtggaagtagcctgcatcaacag
gccgcttttgatgctttgcatgctcatttgagtaaaaacgaccccatgatgtggggctgg
ccagtatggccggaaaaatatcgcgatgggcacagcagtgctgtggctgatttcagtcgt
gagcatgctgatgaagtgaacttctacctgtggctacagtggttggcagccagccagttt
gaggactgtttccgtgccagtcaaacacggaaaatgccgttggggttgtatcgcgatttg
gcggtaggtgtggcagaaggcggcgctgaaacttggtgcgatcgtgagttatattgcctt
aaagcctcagtgggagcgccgcccgatattttagggccgctgggccagaactgggggttg
ccaccaatggatccgcacgtcatggctgctcgcgcttatcagccttttattgatttgttg
cgggctaatatgaccagttgtggcgcgctgcgtattgatcacgtgatggcgttattgcgt
ctgtggtggattccttacggccaaacggcggatcaaggggcttatgtcaaatacccagtt
gatgatctgctggcgatattagcgttagaaagtcagcgccatcgctgcatggtgattggt
gaagatttaggtacggtgccggttgagattgtcggtaagctgcgcgacagcggagtgtat
tcctataaagtgctctattttgagcatgacagcgaaaacactttccgtgcgccacagtct
tatccggtacaagcgatggcaaccatcaccactcatgatctgccgacgctgcgcggttat
tggcaaagtgatgatttgacgttggggaataagctggggctatatccggaccaacagata
ttgaaacagctttatcttgatagagaacgtgcgaaacaaggcttgctagaagggttgcat
cattatgattgcgtgccaacgaaagtgggtcataaagcgtcgttgttgtcgatgagcccg
gttcttaatcgtggattgcagcgctatgttgccgacagtgccagtgcattattgggtttg
cagccggaagattggctggatatggccactccagtaaatattccaggcaccagtgatgaa
tatccaaactggcggcgaaagttgacggcaacattggaagagatgtttgccgatgagcag
gttaatcgtttattgaaagatttggataagcgccgtaagaatgtttcagcggggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system