KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE4013Help
Entry
YE4013            CDS       T00469                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yen00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4367589..4369772)
Genome map
AA seq 727 aa AA seqDB search
MSVLPDRQVINQIISGHYADPFSVLGMHQTERGLQVCALLPDAQEVWLIDTKTGRRVAQL
DCEDPRGFFAVQLTRRKNPFRYQFAVTWQESTQIIEDPYRFGTLLQDIDTWLLAEGTHLR
PYERLGAHLMSLDEVPGVSFAVWAPNAQRVSVVGEFNFWDGRRHPMRLRRENGIWELFLP
GVQAGQLYKFEIIDCHGQVRLKADPYAFKAQMRPETASLISPLPDVVENTPARQKANDLR
SPISIYEVHLGSWRRHTDNNFWLSYGELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRFGTPQDFKDFVAKFHEAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAEG
QWVPNYYGGRENLEAIAFLRYTNHTIGVERPGGVTMAEESTDFPGVTLPPDAGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPISHDEVVHGKRSVLDRMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGCEFAQGREWNFDTSLDWHLLDDENGWHKGVQ
RWVRDLNHCYQQYAPLYELDYQPAGFEWLVVDDHENSVFAFLRRDADGNELIVISNFTPV
PRYNYRVGVPQSGHYREVLNSDSAFYRGSNMGNQGGIHSHPVSSHNHAHSLLLTLPPLST
IYLTRGG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttcccgaccgtcaggtgattaatcagattatttccggccattatgccgat
cctttttccgtattgggtatgcaccaaacagagcgaggattacaggtttgtgcgttattg
ccagatgcccaagaggtttggcttattgataccaagacggggcgtcgagtcgctcaattg
gattgtgaagatccccgtggtttttttgctgtacaacttacccgtcgtaaaaaccccttc
cgctatcaatttgctgttacctggcaagaaagtacacaaatcatcgaagatccctaccga
tttggcactttattgcaggatatcgatacctggttattggctgaaggtacccatttacgc
ccttatgaacgcttaggggcgcatttgatgagtctggacgaggtgccgggagtcagcttc
gctgtttgggcgccaaatgcccagcgtgtctctgtggtgggggaatttaacttttgggat
ggccgccgtcaccccatgcggctacggcgagaaaacggtatttgggagctattcctgccc
ggtgtgcaggcggggcagctgtataagtttgagataatagattgccacggtcaggtgcgg
ttaaaagcggatccctacgcctttaaagcccagatgcggccagaaacagcctcattgatc
agtccgttgcccgatgtggtcgaaaatactcctgctcgacaaaaagccaatgacttgcgt
tcacctatttctatttatgaagtccatcttggttcgtggcgacgccataccgacaataat
ttttggcttagttatggcgaattagccgatcaattggtcgaatacgtcaaatatatgggc
tttacccatgtggaattgctgccgattaatgagcatccgtttgatggtagttggggctat
caaccactagggttatacgccccgacccgccgctttggcacaccacaagatttcaaagat
tttgtcgccaaattccatgaagccggaattaacgtcattcttgactgggttccgggtcat
ttccccagtgatgagcatggtttatcgacctttgatggaaccgcattatatgaatatgcc
gatccgcgtgaaggctaccatcaggactggaataccctgatttataactatggtcgcaat
gaagttcgcaactatttagcgggaaatgcattctactggatggagcgttttggcattgat
gcattacgtattgatgctgttgcttcaatgatttaccgcgattacagccgtgccgaaggg
caatgggtgcccaattattacggtgggcgcgaaaatctggaggcgattgccttcttgcgt
tataccaaccacaccatcggtgttgagcgccccggtggtgtcactatggctgaggagtct
actgacttccctggggtgacattacctcctgatgcgggtggattgggctttaactacaag
tggaatatgggctggatgcatgacacgctcaattacatgcaatgtgatcctgttcaccgc
aaatatcatcataatctaatgactttcggtatgttatacgcctataccgagaactttatt
ttaccgatctctcacgatgaagtggtgcatggcaagcgttcagtccttgatcgtatgcca
ggtgatgcatggcagaaatttgctaacttgcgggcctattatgggtttatgtgggcgcat
ccaggcaaaaaattgctgtttatgggatgtgaattcgcccaagggcgtgagtggaatttc
gataccagcctggactggcatttgctggatgacgaaaacggctggcataaaggagtacag
cgctgggttcgtgatcttaaccattgttatcagcaatatgcgccactttatgagttggat
taccaaccggctggctttgagtggttggtggtggatgaccatgaaaactcggtatttgct
ttcctgcgccgtgacgctgatggtaacgaactgattgttattagtaatttcacgccagtt
ccacgttacaactaccgcgtaggtgtcccgcagagcgggcattaccgtgaagtgttgaac
tctgattcagcgttctatcgtggcagcaatatgggtaatcagggcggtattcatagccac
ccggtgagcagccataaccacgcgcattcattgctgctaactctgccaccgctgtcgact
atttatctgacacggggggggtag

DBGET integrated database retrieval system