KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE4072AHelp
Entry
YE4072A           CDS       T00469                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YE4072A (bcsZ)
Enzymes [BR:yen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YE4072A (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4447589..4448716)
Genome map
AA seq 375 aa AA seqDB search
MVVMFKRLVCILLLLASFGTAAACDWPAWQQFKQHYISESGRVIDPSNPRKVTTSEGQSY
GLFFALVADDRETFDRLLTWTENNLSAGDLTARLPAWLWGQRNEHSWDILDPNSASDADL
WIAYSLLEAGRLWDTRRYQTIGTLLLQRIAKEEVVNIPGLGEMLLPGKIGFNNEERWRLN
PSYLPPQLLARFASLAGPWKAMVKTNQRLWLETAPRGFSPDWVVWQKDKGWQPDETHPNL
GSYDAIRTYLWAGMLSNNSPQKAALIQHFQPMAEVTQQQGLPPEKADTLTGKTTGDGPVG
FSAALLPFLASGPAPFNQQALSQQQKRVQDSPPGADAYYSAVLTLFGQGWAQHRYSFNRQ
GELQPSWNSQCATLK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgatgtttaaacgactggtatgcatcctgctgctgcttgccagttttggtacc
gcagcagcttgtgattggccagcatggcagcagttcaaacaacactatatcagtgagtcg
gggcgagttatcgaccccagcaacccgaggaaagtcaccacgtcggaggggcaaagttac
ggcttgttttttgcgctggtagctgatgatcgcgagacattcgatcgattactcacttgg
acagaaaataacttgtcagcgggagatttaaccgcccgtctacccgcatggttgtggggg
caacgcaatgagcatagctgggatattctcgacccaaactcggcttcggatgctgattta
tggattgcttacagtttattagaggctggccgattgtgggatactcgccgctaccagacc
ataggaaccttgctgctgcaacgcattgccaaagaagaagtggtaaatattcccggctta
ggtgaaatgttattaccgggcaaaattggctttaataatgaagagcgttggcggctcaat
ccgagctacttgccaccacaattgctggcgcgtttcgcctcccttgccgggccgtggaaa
gctatggtgaaaaccaatcagcggctatggctggaaacagcaccgcgtggtttcagccct
gactgggtggtgtggcaaaaagataaaggctggcagccggatgaaactcacccaaatctc
ggtagctacgatgcgattcgtacttacttatgggccgggatgttatcaaataacagtccg
caaaaggcggcacttatccaacacttccaaccgatggctgaagtcacccagcagcaaggt
ttgccaccggaaaaggccgatacgttgactggcaaaacaaccggtgatgggccggttggc
ttttcggcggcattattaccgtttttagccagtggtcctgcaccgtttaatcagcaggcg
cttagccaacaacaaaaacgggtacaagattcacctccgggagccgatgcttactacagt
gcggtgctgacactgtttggtcagggatgggcacaacatcgttatagctttaatcggcag
ggtgagcttcagccctcatggaacagtcaatgcgcaacattaaaataa

DBGET integrated database retrieval system