KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0048Help
Entry
YE105_C0048       CDS       T01480                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YE105_C0048
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YE105_C0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59690..60313)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSKE
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKEELDRRLRGRGQDSEEVIAKRMAQAVAEMTHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcacccagtggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaacctttgtacgacacgcaggtttctatttcgcatacc
acgcgtgctaaacgtcctggggagaatcacggcgagcattacttctttgtatccaaggaa
gagttttgccagatgattgatgacgatgcttttcttgagcatgccaaagtatttgagaat
tactatggcacctcacgtctggcaattgagcaggttctcgcaaccggtgttgatgtgttt
ttagatatcgactggcaaggcgcgcagcaaattcgcgcaaaaatgccgaccgcgcgcagt
atctttattttgcccccatccaaagaagaattggatcgccgtttacgcggccgtgggcag
gatagcgaagaggttattgcaaagcgaatggcgcaagctgtcgcggaaatgacccattat
gcagaatatgattatttaatcgtgaatgatgacttcaatctggcattgtctgatctgaaa
accattattcgcgctgaacgactgcgcttaggccgccagaaacagcggcatgacgcttta
atcaccaaattattggcagactga

DBGET integrated database retrieval system