KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0090Help
Entry
YE105_C0090       CDS       T01480                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C0090
   01230 Biosynthesis of amino acids
    YE105_C0090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C0090
   00030 Pentose phosphate pathway
    YE105_C0090
   00051 Fructose and mannose metabolism
    YE105_C0090
   00052 Galactose metabolism
    YE105_C0090
  Energy metabolism
   00680 Methane metabolism
    YE105_C0090
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YE105_C0090
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YE105_C0090
Protein phosphatases and associated proteins [BR:yep01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YE105_C0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103658..104641
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLEVYGIEDGYLGLFENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEKRKVALQNMKERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKREDLVAEIKAGIEKGKKHAIVAITEKLDNIDELAKYIEQET
GRETRGTVLGHIQRGGAPVPYDRILASRMGAYAVDLLLENHDYSRGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaaaatcggtgtactaacaagcggcggtgatgcgccagggatgaacgcagcc
attcgtggggttgttcgtgctgctttgtcagcaggattggaagtttacggtattgaagat
ggctatcttggcttgtttgagaatcgcatgaggaagctggaccgctatagcgtgtctgac
atgattaaccgcggtggtaccttcctcggttcagcgcgcttcccagagttccgtgatccg
gaaaaacgtaaagtcgccctacagaatatgaaagagcgtggcattgatggcctggtggtt
atcggtggtgacggttcttatgctggtgcagacttgctgaccaaagaaggtggtattcac
tgtgtcggcttgccgggcaccattgataacgatgtggccgggactgactatactatcggt
ttcttcaccgcattgggtaccgtggtagaagctattgaccgcttacgtgatacctcttct
tcacaccagcgcatttccatcgttgaagtgatgggccgttattgtggcgatttgacactg
gcggcggcgattgccgggggctgcgagtttatcgcgatccctgaagttgaattcaaacgt
gaagatttggttgctgaaatcaaagcgggcatcgagaaaggtaaaaagcacgctatcgtt
gctattaccgaaaaactggacaatatcgatgagctggctaaatacattgaacaagaaacc
ggccgtgaaactcgtggcacagtgttaggccatatccagcgcggtggtgctccggttcct
tatgaccgtattctggcttcccgcatgggcgcttatgctgttgacctgttgttggaaaat
catgattactcacgcggcggcttctgcgttggcgtacagaacgagaagatggtgcatgaa
ttaatctccgtttgtatcgcgccagaaaacaagaaaagtaaatttaaagaagattggtac
gatacggcgaaaaaactgttctaa

DBGET integrated database retrieval system