KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0093Help
Entry
YE105_C0093       CDS       T01480                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00010  Glycolysis / Gluconeogenesis
yep00051  Fructose and mannose metabolism
yep00562  Inositol phosphate metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
yep01230  Biosynthesis of amino acids
Module
yep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yep_M00002  Glycolysis, core module involving three-carbon compounds
yep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C0093
   00051 Fructose and mannose metabolism
    YE105_C0093
   00562 Inositol phosphate metabolism
    YE105_C0093
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YE105_C0093
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YE105_C0093
  Exosomal proteins of bladder cancer cells
   YE105_C0093
  Exosomal proteins of melanoma cells
   YE105_C0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ40591
Position
complement(106944..107711)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIANLRKELSTVDGCGVAIAPPAIYLNQAKHELSGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDVGAQYIIIGHSERRTYHNESDEFIAKKFGVLKEIG
LIPVLCIGETEAENEAGQTEAVCAKQLDAVLNTLGAKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAVIAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaaactgaacggtagcactcacatggttaac
gagcttatcgctaacctgcgtaaagaactgagcactgttgacggctgtggcgttgctatt
gccccacctgctatctatctgaatcaagctaaacatgagctgtcaggtagccgcatcgcg
ctgggcgcacaaaacgttgatgtgaatctgtccggcgcatttaccggcgagacttctgct
gaaatgctgaaagatgttggtgctcaatacatcatcatcggccactctgagcgccgtact
tatcacaacgaaagtgatgaatttatcgcgaagaaatttggcgtactgaaagaaatcggc
ctgatcccagtattgtgcatcggtgaaaccgaagcagaaaacgaagccggccaaactgaa
gctgtttgcgctaagcaattagacgccgtgctgaacaccttgggtgctaaagcattcgaa
ggcgcggttatcgcttatgagccaatctgggctatcggtactggcaaatcagcaactcct
gcgcaggctcaagcggttcacaaatttatccgtgaccatatcgccaaacaagacgccgtc
attgccgcacaagttatcattcagtacggcggttccgtgaatgataaaaatgctgcagaa
ctgttcacccagccagatatcgatggcgcgctggttggcggtgcatcactgaaagctgat
gctttcgcggttatcgtgaaagccgctgcaaaagctaaaaaagcctaa

DBGET integrated database retrieval system