KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0093Help
Entry
YE105_C0093       CDS       T01480                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C0093
   01230 Biosynthesis of amino acids
    YE105_C0093
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C0093
   00051 Fructose and mannose metabolism
    YE105_C0093
   00562 Inositol phosphate metabolism
    YE105_C0093
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YE105_C0093
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YE105_C0093
  Exosomal proteins of bladder cancer cells
   YE105_C0093
  Exosomal proteins of melanoma cells
   YE105_C0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(106944..107711)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIANLRKELSTVDGCGVAIAPPAIYLNQAKHELSGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDVGAQYIIIGHSERRTYHNESDEFIAKKFGVLKEIG
LIPVLCIGETEAENEAGQTEAVCAKQLDAVLNTLGAKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAVIAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaaactgaacggtagcactcacatggttaac
gagcttatcgctaacctgcgtaaagaactgagcactgttgacggctgtggcgttgctatt
gccccacctgctatctatctgaatcaagctaaacatgagctgtcaggtagccgcatcgcg
ctgggcgcacaaaacgttgatgtgaatctgtccggcgcatttaccggcgagacttctgct
gaaatgctgaaagatgttggtgctcaatacatcatcatcggccactctgagcgccgtact
tatcacaacgaaagtgatgaatttatcgcgaagaaatttggcgtactgaaagaaatcggc
ctgatcccagtattgtgcatcggtgaaaccgaagcagaaaacgaagccggccaaactgaa
gctgtttgcgctaagcaattagacgccgtgctgaacaccttgggtgctaaagcattcgaa
ggcgcggttatcgcttatgagccaatctgggctatcggtactggcaaatcagcaactcct
gcgcaggctcaagcggttcacaaatttatccgtgaccatatcgccaaacaagacgccgtc
attgccgcacaagttatcattcagtacggcggttccgtgaatgataaaaatgctgcagaa
ctgttcacccagccagatatcgatggcgcgctggttggcggtgcatcactgaaagctgat
gctttcgcggttatcgtgaaagccgctgcaaaagctaaaaaagcctaa

DBGET integrated database retrieval system