KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0203Help
Entry
YE105_C0203       CDS       T01480                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YE105_C0203
   00565 Ether lipid metabolism
    YE105_C0203
   00590 Arachidonic acid metabolism
    YE105_C0203
   00591 Linoleic acid metabolism
    YE105_C0203
   00592 alpha-Linolenic acid metabolism
    YE105_C0203
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     YE105_C0203
    3.1.1.32  phospholipase A1
     YE105_C0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252515..253393
Genome map
AA seq 292 aa AA seqDB search
MGRFWQILIALLLVPTLAQAEEATVEKIHDAPTVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTSDINKDAISSYDWAQNAKKDEVKFQLSLGFPIWRGIAGDNSLLGASYTQRSWWQA
SNSDESSPFRETNYEPQIFLAWATDYELAGWTFREVEFGYNHQSNGKADPTSRSWDRVYT
RLMAQRGNLEIDLKPWYRIPESDSKDDNPDINKYMGYYRLKVGYALGESVFSIDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggtagattttggcagattttaatcgctttattactggtgccgactttggcgcaggca
gaagaagcaacggttgagaagattcatgacgcaccgacagtgcgtggcagtattattgcg
gcaatgttgcaagatcacgataatccgttcttgctttatccgtatgaaacaaactatttg
ttatacacctataccagcgatatcaataaagacgcgataagctcttatgattgggcacag
aatgccaagaaagacgaagttaaattccaactgagtttgggcttccccatctggcgcggt
attgccggtgataactccttactgggcgcttcctatacacaacgttcttggtggcaggca
tccaatagtgatgaatcctcacccttccgtgaaaccaactacgaacctcagatattcctg
gcgtgggcgacagattatgagctggcgggctggacattccgcgaagtagaatttggttat
aatcaccagtctaacggtaaagctgatcctacctcacgtagctgggatcgcgtttatacc
cgcctgatggcgcaacgtggcaacttggaaatcgacctaaagccttggtatcgtatccct
gaaagcgacagcaaagatgacaacccggatatcaataaatacatgggttattatcggttg
aaagtgggctatgccttgggtgaaagtgtgttcagtattgatggccgttataactggaat
accggttatggtggtgctgaaatgggctggagctacccaataaccaagcatgttcgtttc
tatacccaagtgttcagtggttatggtgagtcaatgattgactataactttaggcaaaca
cgggtgggtgtgggtatcatgttgaatgatgtcctttaa

DBGET integrated database retrieval system