KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0207Help
Entry
YE105_C0207       CDS       T01480                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YE105_C0207
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YE105_C0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256862..257917
Genome map
AA seq 351 aa AA seqDB search
MPLDNHMNNWLTREEQFAAFVNGPLLDFWQQRDEDEFLGVDNIPIRYVRFCSPQHTRVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRILDDRNRGHVIKFDDYIEDFA
QLVQREITGSHYQQRFALAHSMGGAILTRYLAREPTVFNAVALCAPMFGIHLPMPGWLAH
RIVDWTEKHQKLRDYYAIGTGQWRPLPYVVNMLTHSRERYRRYLRQYADSPEIRVGGPTY
HWVRESLLVGEQIIAQADKITTPVLLLQASEDRVVHNPAHNAFTQAMTLAGHPCEGGQPK
LIKGARHEILFERDTLRAEALSAILRFFAQHHSSLQHKKPVGPQDSDTTRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagataatcacatgaataactggttgacccgcgaagagcagtttgctgctttt
gttaacggcccattgttagatttctggcagcagcgggatgaagatgagtttctgggggtc
gataatatccccattcgatatgttcgtttttgttcaccgcaacatacccgcgtggtggtg
gtagtgccaggccgcattgaaagttacgttaaatatcccgaagtggcttatgatctattc
cagcaaggctatgatgttattgtgttggatcatcgtgggcagggccgatctgggcgaata
cttgatgatcgtaaccgcgggcatgtgatcaaatttgatgattacatagaagattttgcg
cagctggtgcagcgtgagataaccggaagccattatcagcagcgttttgcattggcccac
tctatggggggggcgattctgacccgttatctggcgcgagaaccgacagtgtttaatgct
gtagcgctctgcgcacccatgtttggtatccatttgccgatgccgggctggctggctcat
cggattgtcgattggactgagaaacatcaaaagttgcgggattactatgcaataggcacc
gggcaatggcgaccattgccctatgtggtcaatatgctgactcacagccgcgagcgctat
cgccgctacttgcgccaatatgctgacagcccagaaatccgcgtcggcgggccaacctat
cattgggttcgtgaaagcctgctggtgggggagcaaattattgctcaagcagacaaaatt
accacaccggttctgttactacaggccagtgaggatcgggtagtacataacccggcccat
aatgcatttactcaggcaatgactctggcggggcacccttgcgaaggggggcagccgaag
ttaattaaaggcgcacgccatgagatcctgttcgaacgggacaccctgcgtgccgaggcg
ctaagcgccatattgcgcttttttgcgcaacatcactcttctttacaacataaaaaacca
gtcggccctcaagactccgacaccaccagaggttag

DBGET integrated database retrieval system