KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0264Help
Entry
YE105_C0264       CDS       T01480                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YE105_C0264
Enzymes [BR:yep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YE105_C0264
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YE105_C0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319000..320022
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGNNHQQAVSSMPGVS
RMTIDLLVKEAEAIAKLGVPVISLFPVIEPGMKSLHAEEAYNPNGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDADGYVINDITKEILVRQALSHADAGAEIVAPSDMMDGR
IGAIRDQLELQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggtaccttccctggtcgccgtatgcgccgtgtgcgccgtcat
gatttcagtcgtcgactggtcgctgaaaatcagctgacagttaatgatttgatctatccg
gtgtttgttatggaaggaaacaaccatcagcaagccgtttcgtctatgccgggtgtctcg
cgtatgacaattgatttgttggtgaaagaagctgaggccattgccaagcttggcgtcccg
gtcatatcgttattcccggtcattgaaccaggtatgaagtcactacacgcggaagaagct
tataacccgaatggcctggtacaacgtactgtacgtgcattaaaagacgctgtaccagag
ttaggtattcttacggatgttgccctcgacccatacacaacccatgggcaagacggtgta
attgatgctgatggttatgtcattaacgatatcaccaaagaaattttagtgcgtcaggcc
ttatcacatgcagacgctggcgcagagattgttgccccgagcgatatgatggatggtcgc
attggtgctattcgcgatcagttagaacttcaagggctagttaatacacaaatcatggcg
tattcagccaagtatgcctcttgttactatggcccattccgcgatgcaattggctccagt
agcaatttgaaaggtggcaataaaaaaacctatcaaatggacccggccaatagcgatgaa
gcgttgcaagaaatcgctcaggacttgcaggaaggggcggatatggtgatggttaaaccg
ggtatgccatatttggatgtggtgcgccgggtgaaagatacctttggggttccgaccttt
gcctatcaggtttctggtgaatatgcgatgcatatggctgcaatacaaaatggctggctg
caagagaaaccgacggtgatggagtcactattgtgctttaaacgcgcgggtgcggatggg
gtattaacctattttgctaagcaagtcgcacaatggctgcatgacgatcagatgcagcgt
taa

DBGET integrated database retrieval system