KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0269Help
Entry
YE105_C0269       CDS       T01480                                 

Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C0269
   01212 Fatty acid metabolism
    YE105_C0269
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YE105_C0269
   00650 Butanoate metabolism
    YE105_C0269
  Lipid metabolism
   00071 Fatty acid degradation
    YE105_C0269
   01040 Biosynthesis of unsaturated fatty acids
    YE105_C0269
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YE105_C0269
   00310 Lysine degradation
    YE105_C0269
   00380 Tryptophan metabolism
    YE105_C0269
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE105_C0269
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YE105_C0269
   00281 Geraniol degradation
    YE105_C0269
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    YE105_C0269
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YE105_C0269
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YE105_C0269
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YE105_C0269
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     YE105_C0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324391..326580)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLKLHWLENGIAELVFDAPGSVNKLDTQTVANLGEALVVLEKQSELKGLLLRSA
KAAFIVGADITEFLSLFNEPPEKLHQWLVFANDIFNRLEDLPVPTIAAINGYALGGGCEC
ILATDFRVASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDALK
VGLVDAVVASEKLVDAALSILKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGMV
MQVAGKHYPAPLTAVKTIEAAAKFGRAEALILETNSFVPLAGSNEARALVGIFLNDQYVK
GQAKKLSKGVSAPKQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDKSLTLGMNEAAKLL
NKQLERGKIDGLKMANILATIQPTLDYAGIERAQVIVEAVVENPKVKAAVLAEIETLIGE
ETVLASNTSTIPIDQLAKPLKRPENFCGMHFFNPVHRMPLVEIIRGTKTSDKTIAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAVGFPERMNKDYRDAVDAMFDNQRFGQKNGQGFYRYTQDTKGKP
RKENDEQVDALLAQVSQPLQKFSDDDIIARTMIPMINEVVRCLEEGIIASPAEGDMALVY
GLGFPPFHGGVFRYLDTIGSANYVEMAQRYTHLGALYQVPPGLRAKAEHNESYYPVAAAL
LDVSISQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacactaaagcttcactggctggaaaacggcattgccgagttg
gtgtttgatgcaccaggttcagttaataagctggatacccaaactgtagccaatctgggc
gaagccttggttgtgttagaaaaacaaagtgaactcaaagggttgctattacgctcagcc
aaagcagcctttattgtcggtgccgatatcaccgagtttctatccctgtttaacgagccg
ccagaaaagttgcatcaatggttggttttcgccaacgatattttcaatcgtttggaagac
ttaccagtgccaaccattgcagcaatcaatgggtatgcactgggtggcgggtgtgaatgt
atcttagcgactgattttcgcgtggcctcgccagaagcacgtatcggtctaccggaaacc
aagctcggaattatgccgggttttggtggttcagttcgcttgccgcggctattaggcgct
gacagtgcgttggaaattatcgcagctggcaaagatattattgccaaagatgccttaaag
gttgggctggttgacgccgttgtcgcctccgaaaagttggtcgatgccgcgttaagtatc
ttgaaacaagcgattgacggaaaactcgactggcaagctgcacgtcgtccgaaattagag
ccattgaagctcaatccgaccgaagccgcaatgtgctttaccattgccaaaggcatggtt
atgcaagtcgccggtaaacactatccggctcccttgactgccgtcaaaactattgaggcc
gctgcaaaatttggccgcgctgaagcattgatactggaaaccaatagttttgttccctta
gctggttccaatgaagcgcgtgcattagtcggtattttcttgaatgaccaatatgttaaa
ggtcaggctaaaaagctgtccaaaggtgtcagcgcccccaaacaggccgcagtgctgggt
gccgggattatgggcggtgggattgcctatcagtcggcactgaaaggtgtgccggtcatc
atgaaagatattaatgacaaatccctcacattagggatgaatgaagcggccaagttgctg
aataagcagctggagcgcggcaagatagatggcctgaaaatggcaaatatcttagcaacc
atccagccaacattagattatgccggtattgaacgcgctcaagtcatcgtggaagcggtg
gtagaaaatccaaaagtcaaagcggcagtcctggcagagattgaaacacttatcggcgaa
gaaactgttctggcttctaacacttcgacaattccgattgatcagctcgccaaacccctt
aaacgcccagaaaacttctgcggcatgcatttcttcaatccagtgcaccggatgccattg
gttgaaattattcgtggcaccaaaacttcagataagactatcgccgcggttgtggcatac
gccacgcaaatgggtaaaaccccgattgtagtcaatgattgcccaggcttctttgttaac
cgcgttttgttcccgtatctggctggattcggcatgttagtcagagacggcgcggacttc
cgccaaattgataaagtgatggaaaagcaatttggctggccaatgggccctgcttatcta
ttagatgtggtgggcattgataccgcgcaccatgcacaggcagtgatggccgttggtttc
cctgagcgcatgaataaagattatcgcgatgcggttgacgcgatgtttgataaccaacgg
tttggtcaaaagaatggccaaggcttctaccgctatacccaagacactaagggtaaaccg
cgtaaagagaatgacgaacaagtagatgcattactggcacaagtcagccagccgcttcag
aaatttagcgatgacgatattatcgcccgtaccatgatcccgatgatcaatgaggtggtg
cgatgcctggaagaaggcattattgccagcccggctgaaggtgatatggcgttggtatat
ggccttggattccctccattccacggcggcgtcttccgttaccttgataccatcggcagt
gcaaattatgtcgaaatggctcaacgctacacccatcttggggcgttgtatcaagtcccg
ccgggattaagagccaaagccgaacataacgaaagctattatcctgtggcagcagcgctg
ctcgatgtttctatcagtcaaccggcatga

DBGET integrated database retrieval system