KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0420Help
Entry
YE105_C0420       CDS       T01480                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:yep00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502406..503146
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLAHEAGVAIMAVYQGEKPLDVAHKKDDSPVTAADLAAHQIIKAGLAALTPDIP
LLSEEDPPTWAVRQHWQRYWLVDPLDGTKEFLSRNGEFTVNIALIDQGVAVLGVVYAPAS
EVMYSAENGQAWKEECGRRMQIEVRDAVPPLVVVSRSHSDAELEDYLAQLGEHQTVAVGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKPLSYIPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgccagttggcccacgaggcaggcgtggcgattatggcggtctat
cagggggagaagccccttgatgtggcccataaaaaagatgattcgcccgttacggcggcg
gatcttgccgcccatcaaattatcaaagccgggttggcggcattgacccctgacattcct
ctgttatctgaagaggatccacctacttgggcagtgcgccagcactggcagcgctattgg
ttggttgacccactggatggcaccaaagaatttttgagccgcaatggcgaattcaccgtc
aatatcgccctgattgaccaaggggtagcagtgttgggggtagtttatgctccggcgagc
gaagtgatgtatagcgcggaaaacggccaggcatggaaagaagagtgtggtcggcgtatg
cagattgaggtgcgtgatgccgttccgccgctggtggttgtcagccgttctcacagtgat
gctgagttggaagattatttggcgcaattgggcgaacatcagacggtagcggttggttca
tcactcaagttttgtttggtcgctgaaggaaaagcgcaactatatcctcgctttgggccg
accaatgtgtgggataccgccgctgggcatgcagtcgccatagctgccggggcacaagtt
cacgattggcagggtaaaccactttcttatatcccacgtgaatctttcctgaaccccggc
tttagagtgtctttgttctag

DBGET integrated database retrieval system