KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0450Help
Entry
YE105_C0450       CDS       T01480                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE105_C0450
Enzymes [BR:yep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     YE105_C0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
533663..534496
Genome map
AA seq 277 aa AA seqDB search
MHLTARDLVLDLTRPQVMGILNVTPDSFSDGGHHNNLDKALQHAERMLSAGATLIDIGGE
STRPGATEVSEQEELDRVVPVVEALAKRFDVWLSVDTSKAAVITESARAGAHLINDIRSL
QEPGALEAAAKTGLPVCLMHMQGQPQSMQQSPHYDDLMADVNQFFKHHIDRCIAAGIAKS
KLLLDPGFGFGKNLAHNYQLLARLAELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAVIAAMQGAQIVRVHDVKETVEAMQVVEATLSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaacggccagagatctggttttggatctcactcgcccacaagtaatgggtatc
ttgaatgtcacaccggattcgttttcagatggtgggcatcacaataatcttgataaagca
ttacaacacgccgaacggatgttatcagccggtgctacgctaattgatattggtggagaa
tctacccgcccaggcgctaccgaagtcagtgaacaagaagaacttgatcgggttgtgcca
gtggtagaagcgctggcaaaacgttttgatgtttggttatctgtcgatacatctaaagcg
gcggtaatcaccgagtcagctcgtgctggcgctcatctcatcaatgatattcgttcatta
caagagcctggtgcacttgaagctgcggctaaaactgggttaccggtgtgtcttatgcat
atgcaagggcagccacagagtatgcagcagtcccctcattacgatgatctgatggccgat
gtaaatcagttttttaagcaccatattgaccgctgtattgcggcgggtatcgcaaaaagt
aaattgttactcgacccaggcttcggtttcggtaaaaatctggcgcataattatcagcta
ttggcacgcttggccgaacttcaccattttgagttgccacttttggtggggatgtcacga
aaatcaatggtcggtcagctactgaatgttccgccacaacagcgggttatcggtagtgtg
gcttgtgctgtgattgccgccatgcaaggtgcacaaattgtcagggtgcacgatgtcaaa
gaaactgtcgaggcgatgcaagtcgtcgaggcaacactttcagcgaagggatga

DBGET integrated database retrieval system