KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0560Help
Entry
YE105_C0560       CDS       T01480                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:yep00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660574..661503
Genome map
AA seq 309 aa AA seqDB search
MDDTPFIIFLKNGVYTERLEVARSHVTLKGENRDGTVIGANTAAGMLNPQGEKWGTSGSS
TVLVNAPNFTAENLTIRNDFDFPANKKKADTDPTKLKDTQAVALLLAENSDKARFKAVKL
EGYQDTLYSKTGSRSYFSDCEISGHVDFIFGSGITVFDNCNIVARDRSDIEPPYGYITAP
STLTTSPYGLIFINSRLTKEPGVPANSFALGRPWHPTTTFADGRYADPAAIGQSVFINTT
MDDHIYGWDKMSGKDKQGEKIWFYPQDSRFFEANSQGPGAAINEGRRQLSAEQLKAFTLP
MIFPDWAVH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggatgacactccttttattattttcctgaaaaatggagtttatactgaaaggctcgag
gtggctcgtagtcatgtcaccctcaaaggagagaaccgcgatggcacggtgatcggtgcc
aatactgcggcggggatgctcaatccacaaggcgaaaaatggggaacttccggcagtagt
actgtgctggttaatgctccgaactttacagctgaaaatctgactattcgtaatgatttt
gattttccagccaataaaaagaaagcggatactgacccaacaaaattaaaagatactcaa
gcggtggcactattattagccgaaaatagtgataaagcgcgtttcaaggcagtgaaactt
gaaggttaccaggatacgctttatagcaaaaccggcagccggagttatttctccgactgt
gaaattagtggtcatgttgattttatttttggctcaggaatcacggtatttgataattgt
aatatcgtggcgcgtgatcgaagtgatattgagccgccttatggctatatcacggccccg
agtacattaacgacctcgccttatggtttgatatttattaacagccgattgaccaaagag
ccaggtgttcccgctaatagttttgctttaggacgtccatggcacccgacaaccactttt
gcggatggccgttatgccgatccggcagcaataggtcagtcggtatttatcaatacgacg
atggatgatcatatttacggttgggataaaatgtctggcaaagataaacaaggcgagaaa
atttggttctatccgcaagattcacgtttctttgaggcaaatagtcaggggccgggagca
gcaattaacgagggacgccgccagttatctgcggagcaacttaaagctttcacattacct
atgattttccctgactgggccgtgcattga

DBGET integrated database retrieval system