KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0576Help
Entry
YE105_C0576       CDS       T01480                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:yep00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:yep00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:yep03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:yep03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680195..680632
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWTLRRPAVLQGEIAIRLPDDTRLLIVADPLPEQDDPLLCDVLHC
LGLNPHQAYALTPDQVAMLPEETQCNSWRLGISEPLAVAGAQLYSPALTGLYQDASAKRA
LWQQICHHEADFYPDASRSGHRVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttactgttacaacagctgggtattacgcagtggacattgcgt
cgcccggccgttttgcaaggtgaaattgccatacgtttacctgatgatacccgcctgtta
attgtcgcagatccgcttcctgagcaggatgacccgctgttgtgcgatgtgttgcactgc
cttgggctaaatccgcatcaggcctatgcgctgacgccggatcaggtggcaatgttaccc
gaagagacacagtgcaacagttggcgattgggcatcagtgaaccgcttgcggttgcgggt
gcgcaattatacagcccggccctgaccggactttatcaagacgcgagcgctaagcgcgca
ctttggcagcagatttgtcatcatgaagcagatttctatcctgacgccagccgatctggc
caccgcgtaccaaattga

DBGET integrated database retrieval system