KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0585Help
Entry
YE105_C0585       CDS       T01480                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YE105_C0585
Enzymes [BR:yep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YE105_C0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689017..690372
Genome map
AA seq 451 aa AA seqDB search
MLLLFHKQGDTLFLAQEIIRKKRDGQVLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFH
DMSMPERVALTMAMRDSGTVLNWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYV
PMISGRGLGHTGGTLDKLEAIPGFDIFPDDSAFRKIIQDVGVAIIGQTSSLAPADKRFYA
TRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYQLSEDLAKAIVSVAN
GAGCKTTALLTDMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGL
AQNDADARAKLQAVLDNGKAAEIFGRMVAAQKGPSDFVERYDSYLPAAMLSKPVFAERPG
IITAMDTRALGMAVVSLGGGRRRATDPIDYSVGLTDMARLGASVDGQQPLAVIHANNEDD
WQQAADAVRAAITLGQKAAEETPVVYRGITE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcttttatttcataagcagggggataccttgtttctcgcacaagaaattatccgt
aaaaaacgcgacggccaggtactgagcgaagaagagattcgtttctttattaatggcatt
cgcgataacgtggtttccgaagggcaaattgccgctctggcgatgaccatttatttccat
gatatgagcatgccagaacgtgtggcgctcactatggcaatgcgtgattctggcaccgtg
ctgaactggaagagcctaaaccttaatggcccgattgtggacaagcactccaccggcggc
gtgggtgatgtgacttccttgatgctcggcccaatggtagcggcctgcggcggctatgta
ccgatgatctcgggtcgtggcttgggtcatactggcggaacattggacaaactggaagcg
attcctggttttgatattttccccgacgacagtgcctttcgcaaaatcattcaggatgtc
ggcgtcgctattatcggccaaaccagctcgctggcaccggcggataagcgcttttatgcc
acccgcgatatcaccgctacagtagattctatcccgctgattaccgcttctattctggct
aaaaagctggctgaagggttggatgcgttggtgatggatgtcaaagtggggtcgggtgct
tttatgccgacttatcagctgtctgaggacttggccaaggccattgtcagtgtcgctaat
ggcgcgggttgtaaaaccaccgcgctgttgactgacatgaatcaggtattggcgtccagt
gccggtaatgcggttgaagtgcgcgaagcggtgcgtttcctgactggcgaatatcgtaac
ccgcgtctgttggaagtgactatggcgctgtgtgtcgagatgctgctatccggcggcttg
gcgcaaaatgacgccgatgctcgtgctaagctgcaagcagtattggataacggcaaagcg
gcggaaatcttcggtcgcatggtcgctgcgcaaaaaggcccgagcgattttgtcgaacgc
tatgacagttacttgcccgctgccatgttaagcaaacccgtgtttgctgaacggccagga
attatcactgctatggatacccgagcattaggtatggccgtagtttcccttggcggtggt
cgccgtcgagcaactgatcctattgactacagtgtgggcctgaccgatatggcccgcttg
ggtgccagtgttgatggtcaacagccattagcggtgattcatgccaacaatgaagatgac
tggcagcaggcagcagatgcagtacgtgcggcaatcacattaggccaaaaagcagcggaa
gaaaccccggtggtttatcgcggtattactgaataa

DBGET integrated database retrieval system