KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0609Help
Entry
YE105_C0609       CDS       T01480                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YE105_C0609
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C0609
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YE105_C0609
Enzymes [BR:yep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YE105_C0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719466..720755
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGNEIAPEVLTKRVQAAFEFPAPVAQVENDIAALELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIEGDFDACQALVKQAFDDEELKQALSLNSANSINISRLLAQICYYFEAVAQLPQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKELGHGAVSDDITKDTMRELAELGYISEPHAAIAYRV
LRDQLQDGEFGVFIATAHPAKFKESVEEILAQELPLPKPLAVRAQLPLLSHDLPADFAQL
RTFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcacaacgagcaggtcagcttcgcgcaagcgattaaa
cagggcctgggcaagcagcaagggttgttcttcccgctggagttgccagagtttgaactg
acagaaattgataaactgctggatctggattttgtcactcgtagcagccgtattctttct
gcttttattggtaatgaaattgcaccagaggtgttaaccaaacgcgttcaggcggcgttt
gagtttccggctccggtcgctcaggttgagaatgatatcgccgcactggagttgttccac
ggcccgacattggcctttaaggacttcggcgcacgttttatggcacaaatgctggccgaa
gtggctggcgaccagccagtgactatcttaaccgcaacctctggtgatactggggcggcg
gtcgctcatgctttctatggcttgaaaaatgtccgcgtggttatcctctatccacgcggc
aaaatcagcccgctgcaagagaagctgttctgtacgttaggtggcaatatccacacggtg
gctattgagggcgattttgatgcttgtcaggcgctggtcaaacaagcctttgatgatgag
gagttaaagcaggcgctgagccttaactctgctaactccattaatatcagccgcttgctg
gctcaaatttgctattacttcgaagctgtagcccagttaccgcaagacgcgcgtaaccaa
ttggttatctccgtgccaagtggcaacttcggtgatttgaccgccggtttgctggcaaaa
tcgttaggtttgccggtaaaacgctttatcgctgccactaatgccaacgacaccgtgccg
cgcttcctggttaacggccagtggcagccgaagccgacggtggcgacgttatcgaatgct
atggatgtcagccagccgaataactggccgcgtgttgaggagctttatcgccgtaaaatc
tggcagttgaaagaattgggccacggcgcagtcagtgatgatatcaccaaagacaccatg
cgcgaattggcggagttagggtatatctcagagcctcatgctgctattgcctatcgtgtg
ttgcgcgatcaattgcaggacggagaattcggggtatttatcgcgacagcgcatccggcg
aaattcaaagaaagtgtagaagagattctggcgcaggaattgccactgccaaaaccactg
gcggtgcgagcgcaattgccattgttatcccatgatttaccagcagattttgcacaatta
cgcactttcttgatggcgttaccgaaataa

DBGET integrated database retrieval system