KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0631Help
Entry
YE105_C0631       CDS       T01480                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE105_C0631
   00670 One carbon pool by folate
    YE105_C0631
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YE105_C0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751622..752104
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDDRVTWATSIDDALALAGDAEEVMVMGGGRVYKQLLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESTFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgattgctgcattggcagcggatcgcgttattggtatggaaaacgcc
atgccatggcacttaccagctgatttagcctggttcaaacgtaacacgctaaataaaccg
gtaattatgggtcgtaagacattcgaatctattggtcgccctctgccggggcggttgaat
attgttatcagtagtcaaccgggaacggatgatcgggtaacctgggcaacctctattgac
gacgcactcgctttggcgggtgatgcagaagaagtgatggtgatggggggcggccgtgtc
tataagcaattattagaccgcgctaaccgtatgtatcttactcacattgatgctgaagtt
gggggcgatacccattttccagattatgagccagatgagtgggaaagtacctttagtgaa
ttccatgatgcagacgaggctaattcacacagctattgtttcgagatccttgaacgccgc
taa

DBGET integrated database retrieval system