KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0709Help
Entry
YE105_C0709       CDS       T01480                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     YE105_C0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
844861..846282
Genome map
AA seq 473 aa AA seqDB search
MIRKWLIGGGILIVAGYLGVAGYIYMTDNARSDTLISEEKQLTNESSPTVSNTKITAQQI
SHLLYQKGCDYCHTSSASLPFYAAIPGVKQLMAYDIQQGSQYFSLEPTLLAIKENRAVPE
ADLAKIESAIAREQMPPQRFAVLHWASSINAEERNQILDWVKSQRAEYFPSTSSRDLQHL
TLQPLPDALPVDSKKVALGSRLFHDPRLSSDNTVSCASCHQLTKGGVDNLATSTGVDGQK
GGINAPTVFNAVFNVNQFWDGRAVDLQQQAGGPPLNPVEMASASWDDIIGKLQQDAQLTQ
EFLQVYPQGYSEHNITDAIAEFEKTLTTPNSPFDRYLKGDADALTASQKNGLALFQKNKC
DTCHVGKNIGGQSYDLMGLKGNYFADRPKELTADDQGRFNITKDPRDMHRFKTPGLRNIA
LTAPYFHDAQAENLNQAVEMMLKYQVGTSLPSQDINDIVAFLESLTGEYTPHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaaaatggctaattggcggaggtatattaatagttgcaggttatctgggtgtc
gcaggttatatctacatgacagataacgcccgcagtgacacattaatcagcgaggaaaaa
caattaaccaatgagtcgtcccccacggtaagtaataccaaaataaccgctcaacagatc
agtcatctgctttatcaaaagggctgcgattactgccacaccagcagtgcctctctaccg
ttttatgccgctattccgggcgtgaaacaattaatggcttacgatattcaacaaggtagc
caatatttctcattggaaccgaccttattagctattaaagaaaatcgcgccgtacctgaa
gcagatttagcaaaaattgaatcggctattgctcgcgaacaaatgccaccacaacgtttt
gccgttttgcactgggcttcgagtatcaatgctgaagaaagaaaccaaattctcgattgg
gttaaatcacaacgagcagaatatttcccttcaaccagcagccgtgatctgcaacatctc
accttacaaccgctgccggatgcattacctgtcgacagtaaaaaagtggcattgggttct
cgcctattccacgatccacggttatccagtgataacaccgtatcttgcgccagctgccat
cagcttacaaaaggtggagtcgataatctggcgacctcaaccggtgttgatggtcagaaa
ggtgggattaatgcaccgacagtcttcaacgccgtattcaatgtgaatcaattctgggat
ggccgcgcggttgatttacaacaacaagccggtggtccgccactgaatccggtagaaatg
gcgtcagcatcgtgggatgacatcattgggaaactgcaacaggatgcccagttaacacaa
gagtttcttcaggtttatccgcagggctattccgaacacaatattactgacgctattgct
gaatttgaaaaaacgctgaccacgccaaatagtccctttgatcgctatttaaaaggtgat
gccgatgccctcaccgccagccagaaaaacggcctggcattattccagaaaaataaatgc
gacacctgccatgtgggtaaaaatattggcgggcagtcgtatgacctgatgggattaaaa
ggcaattactttgctgaccggccgaaagagctgacggcggatgaccaagggcgttttaat
atcactaaagatccgcgcgatatgcaccgttttaaaacaccgggtctgcgtaatattgct
ctgacagccccttatttccacgatgctcaagctgagaatttgaatcaggcagttgaaatg
atgttgaaatatcaggtgggcactagcctgccatcacaggatattaacgatatcgtcgct
ttccttgaaagcctgaccggggaatatactccacataaataa

DBGET integrated database retrieval system