KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0764Help
Entry
YE105_C0764       CDS       T01480                                 

Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C0764
   01230 Biosynthesis of amino acids
    YE105_C0764
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YE105_C0764
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     YE105_C0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901742..902404)
Genome map
AA seq 220 aa AA seqDB search
MTQDELKKAVGWAALEYVKPGTIVGVGTGSTAAHFIDALASIKGQIEGAVSSSDASTAKL
KSYGIQVFDCNEVDELDIYVDGADEINSQMQMIKGGGAALTREKIIAAIARKFICIADAS
KQVDVLGKFPLPVEVIPMARSYVARELVKLGGLPEYRQNVLTDNGNVILDVHNLTILDAI
ALENKINNIAGVVTVGLFANRGADVALIGTADGVKTVELK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggatgaacttaaaaaagcagtaggctgggcagcattagaatatgtcaaacct
ggcactatcgttggggtcggtactggctcaactgcggcacattttatcgatgctcttgct
tccattaaaggccagatcgaaggagctgtttctagctctgatgcctctaccgctaaactg
aaaagttatggcattcaggtatttgattgcaacgaagtcgatgagctggacatttatgtc
gatggtgctgatgaaattaacagccaaatgcagatgatcaaaggcggtggtgcggctttg
acccgcgagaaaatcattgcggccattgcgcgtaaattcatctgtattgccgatgcttcc
aagcaggttgatgtgctgggtaaattcccgttgccggtcgaagttatcccaatggcgcgt
tcttatgtggcgcgtgaactggtgaaattaggcgggttacctgaatatcgccagaatgtt
ttgactgataacggcaatgttattttggatgtccataatctgactattttggatgccatt
gcgcttgaaaataaaattaataatattgccggtgttgtcactgtggggctatttgccaac
cgaggtgctgatgttgcactaattggcactgccgatggtgttaaaaccgtagaacttaag
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system