KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0785Help
Entry
YE105_C0785       CDS       T01480                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YE105_C0785
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YE105_C0785
Enzymes [BR:yep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     YE105_C0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928318..929805
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWGLDAPERALREMTLDSRVAAAGDLFVAIVGHQTDGRRYIPQAIAQGV
AAVVAEADGVAPDASMVEMHGVPVIYLRNLNQHLSKLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWAKMLGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFA
AMEVSSHGLIQNRVAALPFAAAVFTNLSRDHLDYHGNMASYEAAKWLLFSTHQSEHKIIN
ADDEVGRRWLGQLPQAVAVSMENNIPVGWNGPWLSASQVHYHDNGASIAFDSSWGESQLE
SRLMGAFNVSNLLVALATLLSLGYPLTQLLAAASHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALAAARLHCKGQLWCVFGCGGDRDKGKRPLMGGIAEQLADRVVVTDDNPRSEE
PQAIVADILSGLLDAGHAQAIHGRAEAVTSAIMQAKADDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttactcgctccttgggggctagacgccccggagcgt
gcgctacgggaaatgacattagacagccgtgttgccgctgccggggatttatttgtcgct
attgtcggccaccagacggacgggcgtcgctatatcccgcaagccatcgctcaaggtgtg
gcggctgtggttgctgaagctgatggtgtggctccggatgcaagtatggtcgagatgcat
ggtgttccagttatatatctgcgtaatttgaatcagcacttatccaagctggcgggacaa
ttttaccatcagccgggtgccgcattacgtttggtcggtgtgacgggaaccaatggtaaa
accaccaccactcaattgctggcacaatgggctaagatgttgggcgaaaccagcgcagtg
atggggacggttggcaatggtctgttaggccaggttatcccgactgaaaacaccactggc
tcagcggttgatatccagcatttgctacgcaatctggttgaccaaggggcgacttttgcc
gcgatggaagtctcctcccatggtttgattcagaaccgcgtagccgcattgccgtttgct
gccgcagtgttcactaacttaagccgtgatcatctggattatcacggcaatatggcgagt
tacgaagcagcaaaatggctgctgttctccacccatcagtcagagcataaaattattaat
gctgatgacgaagtcggccgccgctggttagggcagctgccgcaagctgtcgccgtcagc
atggaaaacaatattcctgtgggttggaatggcccatggctctccgccagccaagttcat
tatcacgataatggtgccagtatcgcgtttgattcaagctggggcgaaagccagttagaa
agccgcctgatgggggcatttaacgtcagtaacttgctggtggcactggcaacactgctt
tcactgggttacccactaacacaattattagctgccgcatctcatctacaaccggtgtgt
gggcggatggaagtatttaatgcaccgggtaaaccgacggtagtggtggattatgcccac
acaccggatgcattggaaaaagcactggcggcggcacgtttacattgtaaaggccaactg
tggtgtgtgtttggttgcggtggtgatcgtgacaaaggtaagcgcccacttatgggcggt
atcgcggaacaactggctgatcgggtggttgtcactgatgataatccacgtagtgaagag
ccgcaggcgattgtcgccgatatcctcagtggattgctggatgccggacatgcgcaagcc
atccatggccgtgcagaagctgtgaccagcgccatcatgcaagctaaagccgatgatgtg
gtgttgattgccggcaaaggacatgaagattatcaattggtcggtaatcgccgcttggat
tactctgaccgagtcaccgtcgcgcgtttgttgggggtggtggcatga

DBGET integrated database retrieval system