KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0785Help
Entry
YE105_C0785       CDS       T01480                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:yep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:yep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928318..929805
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWGLDAPERALREMTLDSRVAAAGDLFVAIVGHQTDGRRYIPQAIAQGV
AAVVAEADGVAPDASMVEMHGVPVIYLRNLNQHLSKLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWAKMLGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFA
AMEVSSHGLIQNRVAALPFAAAVFTNLSRDHLDYHGNMASYEAAKWLLFSTHQSEHKIIN
ADDEVGRRWLGQLPQAVAVSMENNIPVGWNGPWLSASQVHYHDNGASIAFDSSWGESQLE
SRLMGAFNVSNLLVALATLLSLGYPLTQLLAAASHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALAAARLHCKGQLWCVFGCGGDRDKGKRPLMGGIAEQLADRVVVTDDNPRSEE
PQAIVADILSGLLDAGHAQAIHGRAEAVTSAIMQAKADDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttactcgctccttgggggctagacgccccggagcgt
gcgctacgggaaatgacattagacagccgtgttgccgctgccggggatttatttgtcgct
attgtcggccaccagacggacgggcgtcgctatatcccgcaagccatcgctcaaggtgtg
gcggctgtggttgctgaagctgatggtgtggctccggatgcaagtatggtcgagatgcat
ggtgttccagttatatatctgcgtaatttgaatcagcacttatccaagctggcgggacaa
ttttaccatcagccgggtgccgcattacgtttggtcggtgtgacgggaaccaatggtaaa
accaccaccactcaattgctggcacaatgggctaagatgttgggcgaaaccagcgcagtg
atggggacggttggcaatggtctgttaggccaggttatcccgactgaaaacaccactggc
tcagcggttgatatccagcatttgctacgcaatctggttgaccaaggggcgacttttgcc
gcgatggaagtctcctcccatggtttgattcagaaccgcgtagccgcattgccgtttgct
gccgcagtgttcactaacttaagccgtgatcatctggattatcacggcaatatggcgagt
tacgaagcagcaaaatggctgctgttctccacccatcagtcagagcataaaattattaat
gctgatgacgaagtcggccgccgctggttagggcagctgccgcaagctgtcgccgtcagc
atggaaaacaatattcctgtgggttggaatggcccatggctctccgccagccaagttcat
tatcacgataatggtgccagtatcgcgtttgattcaagctggggcgaaagccagttagaa
agccgcctgatgggggcatttaacgtcagtaacttgctggtggcactggcaacactgctt
tcactgggttacccactaacacaattattagctgccgcatctcatctacaaccggtgtgt
gggcggatggaagtatttaatgcaccgggtaaaccgacggtagtggtggattatgcccac
acaccggatgcattggaaaaagcactggcggcggcacgtttacattgtaaaggccaactg
tggtgtgtgtttggttgcggtggtgatcgtgacaaaggtaagcgcccacttatgggcggt
atcgcggaacaactggctgatcgggtggttgtcactgatgataatccacgtagtgaagag
ccgcaggcgattgtcgccgatatcctcagtggattgctggatgccggacatgcgcaagcc
atccatggccgtgcagaagctgtgaccagcgccatcatgcaagctaaagccgatgatgtg
gtgttgattgccggcaaaggacatgaagattatcaattggtcggtaatcgccgcttggat
tactctgaccgagtcaccgtcgcgcgtttgttgggggtggtggcatga

DBGET integrated database retrieval system