KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0814Help
Entry
YE105_C0814       CDS       T01480                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C0814
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C0814
   00020 Citrate cycle (TCA cycle)
    YE105_C0814
   00620 Pyruvate metabolism
    YE105_C0814
Enzymes [BR:yep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YE105_C0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962286..963869
Genome map
AA seq 527 aa AA seqDB search
MSIEIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDTVATGKLMMIFEATGAAAAPAKAEEKSAAPAPAAAPAASAVKNVEVPDIGGDEVEVT
EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGIVKEIKINTGDKVKTGSLIMVFEVEG
AAPAAASAPAPQAAAPASAAAPAAAPAAKAENKGEFAENDAYVHATPVIRRLAREFGVNL
AKVKGTGRKGRILREDVQAYVKDAVKRAEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEV
ELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKLQNDEAAKRKLDVKFTPVVFI
MKAVAAALEQMPRFNSSLSEDGQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELS
RELMAISKKARDGKLTAGEMQGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPV
WNGKEFQPRLMMPMSLSFDHRVIDGADGARFITIINNMLADIRRLVM
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaagtaccggacatcggtgcagatgaagttgaagtcaccgaaatt
atggtgaaagtgggtgataccgttgaagctgagcaatcacttatcactgttgaaggtgat
aaagcttctatggaagtcccttcaccacaggcaggtgtcgttaaagaaatcaaaattgcg
gttggcgatactgttgcaaccggcaaactgatgatgatcttcgaagcaacaggtgccgct
gcggcacctgctaaagcggaagagaaatcagcggcccctgctccggcagcggctcctgca
gcatcggctgttaaaaatgttgaagtaccagatatcggcggtgatgaagttgaagtcact
gaagtgatggtcaaagtgggcgataaagttgccgctgaacaatcactgattaccgttgaa
ggtgataaagcttcgatggaagtcccggcaccattcgcgggcatcgtgaaagagatcaaa
attaacaccggcgacaaagtgaaaaccggttctctgatcatggtgtttgaagtggaaggc
gcggcacctgcggccgcttcggctccagctccgcaagcagcagcacccgcttcagcggcg
gctcctgcagcagctccagcggcgaaagcagagaacaaaggcgagttcgctgagaatgat
gcttatgtgcatgcaacgccggttatccgtcgtttggcccgtgaatttggcgtgaatctg
gcgaaagtgaaaggtacgggtcgtaaaggccgtatcctgcgcgaagacgttcaggcttat
gtgaaagatgcggtcaaacgtgctgaagcggctcctgcggctgccaccggtggtggtctg
ccaggcatgctgccttggccgaaagttgatttcagcaagttcggcgaaatcgaagaagtg
gaattgggtcgtatccagaaaatctctggtgctaacttgagccgtaactgggtcatgatt
ccacatgtaactcacttcgacaaaaccgatatcactgatctggaagcgttccgtaagctg
cagaacgacgaagctgctaagcgtaagctggacgtgaagttcaccccagtggtgttcatc
atgaaagctgttgctgctgccctcgagcagatgccacgtttcaacagctcactgtccgaa
gatggtcagaagctgacgctgaaaaagtacatcaatatcggtgtcgcggtagatacgcca
aatggtttggtcgttccggtattcaaggatgtgaacaagaaaagcatcactgaactgtcc
cgtgaactgatggctatctccaagaaagcgcgtgatggcaagttgaccgctggcgaaatg
cagggcggttgcttcaccatctccagcctgggcggtatcgggacaactcacttcgcgccg
attgttaacgcgccggaagtggctatcttgggtgtctccaagtctgcgatagagccagtc
tggaacggtaaagagttccagccgcgtctgatgatgccgatgtcgctctccttcgaccac
cgtgtgatagacggtgctgatggtgcgcgctttatcactatcatcaacaatatgctggcc
gacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system