KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0885Help
Entry
YE105_C0885       CDS       T01480                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YE105_C0885
Secretion system [BR:yep02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YE105_C0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1048782..1049498
Genome map
AA seq 238 aa AA seqDB search
MKKSLLLLPIVIAAFTGLAHADDAAIQQTLKKLDIQKADIQPSPIPGLSTVMTDSGVLYI
SADGKHLLQGPLYDVSGSQPVNVTNQMLVKKLEALSKEMIVYKASQEKHVVTVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCMADRNKAFDDAMKGVDIS
PATCKTDISEHYKLGVQFGIQGTPAIVLQNGTIVPGYLEPKEMLQMLNKHQASSKTAG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttattactgctgccgatcgttatcgctgcattcacggggctggctcat
gctgatgatgccgctatccaacagacactgaaaaagttggatattcagaaagctgacatc
caaccatcacctatccccggcttgagtaccgtgatgactgacagcggtgtgctttatatt
tccgccgatggtaaacacttgttgcaagggccgctgtacgatgttagcggtagccaaccg
gtgaatgtaaccaaccagatgctggtgaaaaagttggaagcattgagcaaagaaatgatt
gtgtataaggcgtcgcaagaaaaacacgttgttaccgtgtttactgatatcacctgcggc
tattgtcataaattgcacgaacaaatgagtgattataacgcgctggggattaccgtgcgt
tatctggccttcccacgtcaggggttgagctctcaggcagaaaaagacatgcgctcaatc
tggtgtatggctgatcgcaacaaagcattcgatgatgcgatgaaaggtgtcgatatatca
cctgcaacctgtaaaaccgatatttctgagcactataagttaggtgtgcagtttggtatt
cagggtactccagccatcgtgttgcaaaatggcactatcgttccaggttatctggagcca
aaagaaatgttacagatgctgaataagcaccaggcttcctcaaaaacggcgggttaa

DBGET integrated database retrieval system