KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0948Help
Entry
YE105_C0948       CDS       T01480                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127110..1129011
Genome map
AA seq 633 aa AA seqDB search
MMTLLEQAVRDHLLRPLDVQFSRMIAGDNDPMLQLAAAVLSAEAGAGHVCLPLSYLQPDQ
LFDGRQPALSQALWQAVGAPDQLHWTQKLNSSPAVSDGSQPTPLVLQNDRLYLQRMWQYE
GDVVRFIASDNMASLINETSDGSETRDVNETLLRDTLDRLFGPAENEVDWQKVAAAVAAT
RRISVISGGPGTGKTTTVAKLLTALIQLSQGQRLRIQLAAPTGKAAARLTESLGNAIRQL
SLTDDERKLFPDQASTLHRLLGAQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARLI
AALPTKAQVIFLGDRDQLASVEAGAVLGDICRFAELGYSAPRAKQLARLTGCTLVGNIPI
GEVETDTVNVRDSLCLLRKSYRFDEKSGIGQLALAVNAGRYRDALAVFNGTYSDIERFSL
ADSDDYQVLLEDCAAGYQHYLELAAAGADAVDVLAAFGRYQLLCALRAGPFGVSGLNERI
EQLLHRKRLIERTPGPSGRWYVGRPVMIGLNDSALGLFNGDIGIALPDPEGELRVHFQLP
DGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQ
RLTLYCNDKVLSRAIQTPTQRVSGLVDRLNQLT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttactggagcaagcggttcgtgaccacttactacggccactggatgttcag
ttctcgcggatgatagccggtgataatgatcccatgttgcaactggcagctgctgttctc
agtgctgaagctggtgctgggcacgtgtgtctaccattgagttatttgcagccagaccag
ctgtttgatggccgacagccagcgctatcacaagcactgtggcaggctgtcggtgcgcca
gatcaattacattggacacaaaaactcaatagctccccggcagtcagcgatggttcgcaa
cccacccccttagtgttgcaaaatgaccgtttgtatttacaacggatgtggcaatacgaa
ggtgatgtcgtgcgctttattgccagtgataatatggcgtcgcttatcaacgaaaccagt
gacggcagcgaaaccagagacgtcaacgaaacattattaagagatacgcttgatcgccta
tttgggccggcagaaaatgaggttgactggcaaaaagtcgccgcggcggtagcggctacc
cgccgtatttccgtgatttccggtggtccagggacggggaaaacaacgacggtagccaag
ttattgaccgcattgatacaactgagccaagggcaacgtttacgtatccaacttgccgct
ccaaccggtaaagctgccgcacggttaactgaatcgctggggaacgccattcgccagctc
tcactaactgacgatgaacgcaagctattcccagatcaagcatccacattgcaccgttta
ttgggtgcacaacctaacagccagcgcttacggtaccatcgtggtaaccctctaaacctt
gatgtgctggtggttgatgaagcatcaatggtggatttgcccatgatggcgcggctcatt
gcagcattacccactaaagctcaggttatttttctcggtgaccgtgaccaattggcttcg
gtagaggcgggagctgtactgggtgatatatgtcgttttgctgagttgggttacagcgcg
cctagagctaaacagttagctcgcttaacgggatgcacattagtaggaaatatcccgatt
ggtgaggtggagacagataccgtcaatgtccgagatagtttgtgtttgctgcgcaaaagt
taccgcttcgatgaaaaatccggtatcgggcaacttgctttagcggttaatgccgggaga
tatcgtgatgcgttagccgtttttaacggtacatattcggatatcgagcgcttttctctg
gcagattccgatgattatcaggtattgctggaggactgtgctgctggttatcagcactat
cttgaactggcagccgcaggtgctgatgcggtggatgtacttgctgcatttggccgctat
caactgttatgcgcattacgcgccgggccatttggtgtcagtggcttaaacgagcggatc
gaacaactattgcatcgcaagcgattaatagagcgaacgccagggccatcgggccgttgg
tatgttggcaggccggtgatgataggattgaatgacagtgcgctgggtttattcaacggc
gatattggtattgctttacctgatcctgaaggtgagttgcgggtgcatttccaattaccg
gacggcaatatcaaatcggtgcagccgagtcgtcttcccagccatgaaactgcttatgct
atgaccgtacataaatctcaagggtcggagtttgagcatactgcattggttctacccaat
acttttatgccggtgttaacccgcgaattggtctataccgccattacccgtgcccgtcag
cgtttgacattgtattgcaatgataaggtattgagccgagctatccagacacccacacag
cgtgttagcggattagtagaccgtttgaatcaattgacttga

DBGET integrated database retrieval system