KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0948Help
Entry
YE105_C0948       CDS       T01480                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YE105_C0948
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YE105_C0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127110..1129011
Genome map
AA seq 633 aa AA seqDB search
MMTLLEQAVRDHLLRPLDVQFSRMIAGDNDPMLQLAAAVLSAEAGAGHVCLPLSYLQPDQ
LFDGRQPALSQALWQAVGAPDQLHWTQKLNSSPAVSDGSQPTPLVLQNDRLYLQRMWQYE
GDVVRFIASDNMASLINETSDGSETRDVNETLLRDTLDRLFGPAENEVDWQKVAAAVAAT
RRISVISGGPGTGKTTTVAKLLTALIQLSQGQRLRIQLAAPTGKAAARLTESLGNAIRQL
SLTDDERKLFPDQASTLHRLLGAQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARLI
AALPTKAQVIFLGDRDQLASVEAGAVLGDICRFAELGYSAPRAKQLARLTGCTLVGNIPI
GEVETDTVNVRDSLCLLRKSYRFDEKSGIGQLALAVNAGRYRDALAVFNGTYSDIERFSL
ADSDDYQVLLEDCAAGYQHYLELAAAGADAVDVLAAFGRYQLLCALRAGPFGVSGLNERI
EQLLHRKRLIERTPGPSGRWYVGRPVMIGLNDSALGLFNGDIGIALPDPEGELRVHFQLP
DGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQ
RLTLYCNDKVLSRAIQTPTQRVSGLVDRLNQLT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttactggagcaagcggttcgtgaccacttactacggccactggatgttcag
ttctcgcggatgatagccggtgataatgatcccatgttgcaactggcagctgctgttctc
agtgctgaagctggtgctgggcacgtgtgtctaccattgagttatttgcagccagaccag
ctgtttgatggccgacagccagcgctatcacaagcactgtggcaggctgtcggtgcgcca
gatcaattacattggacacaaaaactcaatagctccccggcagtcagcgatggttcgcaa
cccacccccttagtgttgcaaaatgaccgtttgtatttacaacggatgtggcaatacgaa
ggtgatgtcgtgcgctttattgccagtgataatatggcgtcgcttatcaacgaaaccagt
gacggcagcgaaaccagagacgtcaacgaaacattattaagagatacgcttgatcgccta
tttgggccggcagaaaatgaggttgactggcaaaaagtcgccgcggcggtagcggctacc
cgccgtatttccgtgatttccggtggtccagggacggggaaaacaacgacggtagccaag
ttattgaccgcattgatacaactgagccaagggcaacgtttacgtatccaacttgccgct
ccaaccggtaaagctgccgcacggttaactgaatcgctggggaacgccattcgccagctc
tcactaactgacgatgaacgcaagctattcccagatcaagcatccacattgcaccgttta
ttgggtgcacaacctaacagccagcgcttacggtaccatcgtggtaaccctctaaacctt
gatgtgctggtggttgatgaagcatcaatggtggatttgcccatgatggcgcggctcatt
gcagcattacccactaaagctcaggttatttttctcggtgaccgtgaccaattggcttcg
gtagaggcgggagctgtactgggtgatatatgtcgttttgctgagttgggttacagcgcg
cctagagctaaacagttagctcgcttaacgggatgcacattagtaggaaatatcccgatt
ggtgaggtggagacagataccgtcaatgtccgagatagtttgtgtttgctgcgcaaaagt
taccgcttcgatgaaaaatccggtatcgggcaacttgctttagcggttaatgccgggaga
tatcgtgatgcgttagccgtttttaacggtacatattcggatatcgagcgcttttctctg
gcagattccgatgattatcaggtattgctggaggactgtgctgctggttatcagcactat
cttgaactggcagccgcaggtgctgatgcggtggatgtacttgctgcatttggccgctat
caactgttatgcgcattacgcgccgggccatttggtgtcagtggcttaaacgagcggatc
gaacaactattgcatcgcaagcgattaatagagcgaacgccagggccatcgggccgttgg
tatgttggcaggccggtgatgataggattgaatgacagtgcgctgggtttattcaacggc
gatattggtattgctttacctgatcctgaaggtgagttgcgggtgcatttccaattaccg
gacggcaatatcaaatcggtgcagccgagtcgtcttcccagccatgaaactgcttatgct
atgaccgtacataaatctcaagggtcggagtttgagcatactgcattggttctacccaat
acttttatgccggtgttaacccgcgaattggtctataccgccattacccgtgcccgtcag
cgtttgacattgtattgcaatgataaggtattgagccgagctatccagacacccacacag
cgtgttagcggattagtagaccgtttgaatcaattgacttga

DBGET integrated database retrieval system