KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0948Help
Entry
YE105_C0948       CDS       T01480                                 

Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:yep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YE105_C0948
Enzymes [BR:yep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YE105_C0948
DNA repair and recombination proteins [BR:yep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     YE105_C0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 PhoH AAA_16 UvrD_C CbiA AAA_28 T2SSE Herpes_Helicase FtsK_SpoIIIE MukB ArgK AAA SRP54 Flavi_DEAD NACHT TrwB_AAD_bind AAA_29 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADZ41444
Position
1127110..1129011
Genome map
AA seq 633 aa AA seqDB search
MMTLLEQAVRDHLLRPLDVQFSRMIAGDNDPMLQLAAAVLSAEAGAGHVCLPLSYLQPDQ
LFDGRQPALSQALWQAVGAPDQLHWTQKLNSSPAVSDGSQPTPLVLQNDRLYLQRMWQYE
GDVVRFIASDNMASLINETSDGSETRDVNETLLRDTLDRLFGPAENEVDWQKVAAAVAAT
RRISVISGGPGTGKTTTVAKLLTALIQLSQGQRLRIQLAAPTGKAAARLTESLGNAIRQL
SLTDDERKLFPDQASTLHRLLGAQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMARLI
AALPTKAQVIFLGDRDQLASVEAGAVLGDICRFAELGYSAPRAKQLARLTGCTLVGNIPI
GEVETDTVNVRDSLCLLRKSYRFDEKSGIGQLALAVNAGRYRDALAVFNGTYSDIERFSL
ADSDDYQVLLEDCAAGYQHYLELAAAGADAVDVLAAFGRYQLLCALRAGPFGVSGLNERI
EQLLHRKRLIERTPGPSGRWYVGRPVMIGLNDSALGLFNGDIGIALPDPEGELRVHFQLP
DGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFMPVLTRELVYTAITRARQ
RLTLYCNDKVLSRAIQTPTQRVSGLVDRLNQLT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttactggagcaagcggttcgtgaccacttactacggccactggatgttcag
ttctcgcggatgatagccggtgataatgatcccatgttgcaactggcagctgctgttctc
agtgctgaagctggtgctgggcacgtgtgtctaccattgagttatttgcagccagaccag
ctgtttgatggccgacagccagcgctatcacaagcactgtggcaggctgtcggtgcgcca
gatcaattacattggacacaaaaactcaatagctccccggcagtcagcgatggttcgcaa
cccacccccttagtgttgcaaaatgaccgtttgtatttacaacggatgtggcaatacgaa
ggtgatgtcgtgcgctttattgccagtgataatatggcgtcgcttatcaacgaaaccagt
gacggcagcgaaaccagagacgtcaacgaaacattattaagagatacgcttgatcgccta
tttgggccggcagaaaatgaggttgactggcaaaaagtcgccgcggcggtagcggctacc
cgccgtatttccgtgatttccggtggtccagggacggggaaaacaacgacggtagccaag
ttattgaccgcattgatacaactgagccaagggcaacgtttacgtatccaacttgccgct
ccaaccggtaaagctgccgcacggttaactgaatcgctggggaacgccattcgccagctc
tcactaactgacgatgaacgcaagctattcccagatcaagcatccacattgcaccgttta
ttgggtgcacaacctaacagccagcgcttacggtaccatcgtggtaaccctctaaacctt
gatgtgctggtggttgatgaagcatcaatggtggatttgcccatgatggcgcggctcatt
gcagcattacccactaaagctcaggttatttttctcggtgaccgtgaccaattggcttcg
gtagaggcgggagctgtactgggtgatatatgtcgttttgctgagttgggttacagcgcg
cctagagctaaacagttagctcgcttaacgggatgcacattagtaggaaatatcccgatt
ggtgaggtggagacagataccgtcaatgtccgagatagtttgtgtttgctgcgcaaaagt
taccgcttcgatgaaaaatccggtatcgggcaacttgctttagcggttaatgccgggaga
tatcgtgatgcgttagccgtttttaacggtacatattcggatatcgagcgcttttctctg
gcagattccgatgattatcaggtattgctggaggactgtgctgctggttatcagcactat
cttgaactggcagccgcaggtgctgatgcggtggatgtacttgctgcatttggccgctat
caactgttatgcgcattacgcgccgggccatttggtgtcagtggcttaaacgagcggatc
gaacaactattgcatcgcaagcgattaatagagcgaacgccagggccatcgggccgttgg
tatgttggcaggccggtgatgataggattgaatgacagtgcgctgggtttattcaacggc
gatattggtattgctttacctgatcctgaaggtgagttgcgggtgcatttccaattaccg
gacggcaatatcaaatcggtgcagccgagtcgtcttcccagccatgaaactgcttatgct
atgaccgtacataaatctcaagggtcggagtttgagcatactgcattggttctacccaat
acttttatgccggtgttaacccgcgaattggtctataccgccattacccgtgcccgtcag
cgtttgacattgtattgcaatgataaggtattgagccgagctatccagacacccacacag
cgtgttagcggattagtagaccgtttgaatcaattgacttga

DBGET integrated database retrieval system