KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1171Help
Entry
YE105_C1171       CDS       T01480                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YE105_C1171
DNA repair and recombination proteins [BR:yep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      YE105_C1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394093..1394698
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEHCTICSNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLETETISEVILATNPTVEGDATANYIGQMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccactccttgaatcattgatggaggcgttgcgctgcttgccgggcgtt
ggcccgaaatcggcgcaacgtatggcatttcaattgctacagcgggatcgtagcggtgga
atgcgcctggcacagtcattgacgcgcgcaatgtctgaaattggccactgcgctgactgc
cgtacttttaccgagcaagagcattgcactatttgctctaatccgcggcggcaacaaaat
ggtcaaatctgcgtggtcgaaagcccggcagatattcatgccattgagcaaacgggccag
tttggcgggcgctattttgtgttgatggggcatttatctcccatggacggcataggtccc
ggtgatattggtttggatttgcttgaaaaacggctggaaactgaaactatcagtgaagtc
attctggcgaccaacccgacagtcgaaggggatgcaaccgctaactatattggtcagatg
tgcggccagtatggtgtgttagccagccgtattgcacacggtgtgccagttggcggtgag
ttggaaatggttgatggtacaaccctatcccactcattagcggggcgtaatcccattaag
tactag

DBGET integrated database retrieval system