KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1196Help
Entry
YE105_C1196       CDS       T01480                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:yep01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425782..1426354)
Genome map
AA seq 190 aa AA seqDB search
MRAAATDTLLILGDSLSAGYRLPIAEAWPSRLDKTWQATPSLPKVVNASISGDTAAQGLA
RLPALLKQHQPRWVLIELGANDGLRGFPPQDIQRDLTQIINLIKEANAQPLLMQILIPPN
YGRRYTDAFTAMYPQLAQQFSIPLVPFFMEQVAVKTEWMQDDGLHPNALAQPFIADWMAQ
QLKPLVTNKS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgccgccgcaaccgatacacttttgattctcggcgacagtttaagcgccggttac
cgcctgccgattgctgaagcctggccctcgcggttggataaaacatggcaggccacccca
tcattacccaaggtggttaacgccagtatcagtggggatactgcggcgcaaggcttggcc
cgcttgcctgccctgctgaaacaacatcagccccgctgggtgctgattgaactgggtgcc
aatgacggcctgcgcggtttcccaccgcaggatattcaacgggatctcacgcaaattatc
aatctgataaaggaggccaatgcccagcccttattgatgcaaatcctcattccgcctaac
tatggccgccgttatactgatgctttcaccgctatgtatccgcagttggcgcaacaattc
agcattcctttggtgcctttctttatggaacaagttgccgtaaaaaccgagtggatgcag
gatgatggtttacatcctaacgcactggcgcaacctttcattgctgattggatggcgcaa
caacttaaaccgttagtcacaaataagtcttag

DBGET integrated database retrieval system