KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1254Help
Entry
YE105_C1254       CDS       T01480                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE105_C1254
Enzymes [BR:yep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YE105_C1254
Peptidases [BR:yep01002]
 Cysteine Peptidases
  Family C44
   YE105_C1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1485745..1487409)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLFNAAHTHILAVNGEIYNHQALRQQYGDRYKFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYVGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDFDNVKNNVTDKVELANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFSARRVEDDERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPHSVAWRQKEQFSDGVGYNWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPSSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKSMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcctcgaccttaaaactgaccccattgagttacgcaaaaaa
gcgctggaaatgtcacgtctaatgcgccaccgcggcccggactggtcaggtgtatgggca
aatgataaagccatactcgcccatgaacgcttatctattgttgacgtcaatactggtgca
cagcccctgtttaacgcggcgcacacacatattctggcggtcaatggtgaaatttataat
catcaggcattacgccagcaatacggcgaccgttataaattccagaccgggtctgactgt
gaagtcattctggcgctgtatcaggagaaagggcctgaattccttgacgacctgcaaggt
atgttcgctttcgtcctatacgatacggaaaaagacgcttacctgattgggcgtgaccac
ctgggtattatcccgctgtacgtgggccacgatgaacacggtaatatgtttgtggcttca
gaaatgaaagccttggttccggtttgccgtaccatcaaagaattcccggccggaagctat
ctgtggagtcaggatggcgaaattcgcgagtattatcatcgcgactggtttgatttcgat
aatgtcaaaaacaatgtcactgataaagttgaactggcaaatgcgttagaagatgcggtt
aaaagtcatttgatgtccgacgttccttacggcgtgctgctctctggcggtctggattcc
tcggttatttcggctatcaccaaaaaattttcggctcgtcgcgtagaagatgatgaacgc
agtgaagcctggtggccacaattgcactccttcgccgtgggtttgataggttcacctgat
ttgcgcgccgcgcaagaggtcgccaaccatttgggtaccgtgcatcatgaaattcacttc
accgtgcaggaaggtctggatgccatccgtgatgtgatttatcacattgaaacttatgat
gtcaccactatccgcgcctcaacaccaatgtacttgatgtcgcgtaaaatcaaggcgatg
ggtatcaaaatggtgctatctggtgaaggttctgacgaagtatttggcggttacctctat
ttccacaaagcgccaaatgccaaagaattgcatgaagaaaccgtgcgcaagctgttagcc
ctgcatatgtatgactgcgctcgtgccaacaaagcgatgtctgcctggggtgttgaagcg
cgtgtaccattcctggataaaaacttccttgatgtggcgatgcgaattaacccgcaggat
aaaatgtgcggtaatggcaaaatggaaaaacatgtactgcgtgaatgttttgaatcctac
ctgccacatagcgtcgcatggcgtcagaaagaacaattctccgatggtgtgggttacaac
tggattgatacattaaaagagaaagctgccgagcaagtcactgatcaacagatggaaact
gcgcacttccgttttccatacaacacgccgtcctccaaagagggctacttgtatcgagaa
atttttgaagagctattcccactgccaagtgcagcggaatgcgtgcctggcggcccttca
gtagcatgttcatcagctaaagctattgaatgggatgaatcattcaaaagcatggatgac
ccttctggtcgcgctgtaggcgtgcatcaggatgcttacaaataa

DBGET integrated database retrieval system