KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1293Help
Entry
YE105_C1293       CDS       T01480                                 

Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C1293
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE105_C1293
   00650 Butanoate metabolism
    YE105_C1293
  Energy metabolism
   00190 Oxidative phosphorylation
    YE105_C1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1542796..1543143
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVLYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAVRLVLQLAVVIMLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgactggctgttactgcgt
gcttctgcaatcgtcatcactctatatgttctttatattctgggcttcgttgttattgtc
ccagacatcacctacgaaatctggcgtggcttctttgcttcgcacatcacaaaagtattt
accctgctgacattgctgtcgattctggctcatgcctggattggtctatggcaggtatta
acggactatatcaagccgctagcggtacgactggtgttacaactggccgtggtgattatg
ctgctggtctacctcttgtatggaacaattgtggtgtggggtgcttaa

DBGET integrated database retrieval system