KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1297Help
Entry
YE105_C1297       CDS       T01480                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C1297
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE105_C1297
  Amino acid metabolism
   00310 Lysine degradation
    YE105_C1297
Enzymes [BR:yep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YE105_C1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1548790..1550001
Genome map
AA seq 403 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGLPTEEKSQSTESTPAQRQTASLEEESNDTLSPAIRR
LIAEHSLDASAIKGSGVGGRITREDIDNHLVTRKSAPAAVENKVEAAALAGRSEKRVPMT
RLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGVRLGFMSFYIKAV
VEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTMGMADIEKKIKEL
AVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQV
VILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtcgccgatggctcggta
gcaacctggcacaaaaaaccgggtgatagcgtcaaacgcgatgaagtgctggttgagatt
gaaacagacaaagtgattctggaagttccggccagccaagacggtattttggatgccatt
ttggaagacgaaggtgccactgtgacttcgcgtcaagtgttgggccgtattcgtccaagt
gacagctctggcttgccgaccgaagaaaaaagccaaagcaccgagtccacccctgctcag
cgccaaaccgccagcctggaagaagaaagcaacgatactctcagcccggcgatccgtcgt
ctgattgcagaacactctcttgatgcttccgccattaaaggcagtggtgtgggtggtcgt
atcacgcgtgaagatattgataaccatttggtaacgcgtaaatcagcacctgctgccgtg
gaaaacaaagttgaagctgccgcacttgctggccgcagcgaaaaacgtgttccgatgacg
cgtctacgtaaacgtgttgccgagcgcctgctggaagctaaaaacagcaccgcaatgttg
actacgtttaacgaaatcaacatgaagccaatcatggatctgcgcaagcagtacggtgag
gctttcgagaagcgtcacggtgtgcgtctgggctttatgtccttctatatcaaggccgtg
gttgaagcgctgaaacgctatccagaagtgaatgcttctatcgatggcgaagatgtggtt
taccataattactttgatgtcagcattgccgtttctaccccacgcggcctggttacccct
gtattacgtgatgtagatactatgggtatggctgatattgagaagaaaatcaaagagctg
gctgtaaaaggccgtgacggcaaactgaaggttgaagaactgactggcggtaatttcact
attaccaatggcggcgtattcggctcattgatgtcgaccccgatcattaacccaccacaa
agcgcgatccttggtatgcatgctatcaaagacaggcctatggcggtcaatggtcaggta
gtgattctgccaatgatgtatctggcactgtcctacgaccaccggttgatcgatggccgc
gaatccgttggctatctggtgacggtgaaagagatgctggaagatccagctcgcttactg
ctggatgtataa

DBGET integrated database retrieval system