KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1298Help
Entry
YE105_C1298       CDS       T01480                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C1298
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE105_C1298
   00640 Propanoate metabolism
    YE105_C1298
   00660 C5-Branched dibasic acid metabolism
    YE105_C1298
Enzymes [BR:yep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YE105_C1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1550115..1551281
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDAHGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKVALDPLTGPQPYQGRELAFKLGLTGKQVAQFTKI
FMGLATLFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDKSQEDE
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggtatgccagcgcca
actggctacgcttgtaccacaccgcgtgaagcagaagaagccgcatctaaaatcggtgct
ggcccgtgggtggttaaatgtcaggtacatgctggtggtcgcggtaaagcgggcggcgtg
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggttgggtaaaaag
ctggtcacttaccagacagatgcgcatggtcaaccggttcaccaaattttggttgaagca
gcgactgatatcgacaaagagctatatctgggtgcggttattgaccgtagctcccgtcgt
gtggtgtttatggcatccactgaaggcggcgttgaaattgaaaaagtggccgaagaaaca
ccagaactgatccataaggtcgcattggatccattgactggcccgcagccttatcaaggt
cgcgaattggcattcaaactgggtttaactgggaagcaagtggctcagttcaccaagatc
tttatgggtctggcgactctgttcctggaacgtgacttggcgatggttgagataaacccg
ctggttatcaccaaacagggtgatctggtttgtttggatggcaaactgggtgccgatggt
aacgctttgttccgtcaaccagaattacgtgaaatgcgtgataaatctcaggaagatgag
cgcgaagcacaggctgcacagtgggaactgaactatgtcgccttggatggcaacattggt
tgcatggtaaacggtgccggcttggcaatgggtactatggatattgtgaaactgcacggt
ggtgaaccagctaacttccttgatgtggggggcggtgccactaaagagcgcgtgactgaa
gcgttcaaaatcattttgtctgatgacaaagtgaaagcagttttcgttaatatcttcggc
ggtattgtgcgctgtgacctgattgctgacggcattattggtgcagttgaagaagtgggt
gtcaacgtgccagttgtagtgcgtttggaagggaataacgccgagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system