KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1310Help
Entry
YE105_C1310       CDS       T01480                                 

Definition
quinolinate synthetase
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:yep00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564761..1565822
Genome map
AA seq 353 aa AA seqDB search
MSETFDVNAAIYPFPARPVPLDVDQKAFYREKIKTLLKQRDAVLVAHYYTDPEIQALAEE
TGGCVADSLEMARFGNNHSASTLLVAGVRFMGETAKILNPEKQVLMPTLNAECSLDLGCP
ADEFAAFCDSHPDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGEKIIWAPDRH
LGNYVQKRSGADVLCWQGACIVHDEFKTQALAQMKALHPDAAVLVHPESPQAVVDMADAV
GSTSQLIMAAKTLLQKKLIVATDRGIFYKMQQACPDKELFEAPTAGEGATCRSCAHCPWM
AMNGLKAIAEGLEQGGVMHEIHVDEQLRQQALIPLNRMLGFANELKLQSKGNA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacttttgatgtgaatgcagcgatttatcctttccctgcgcggcctgtcccg
ctggatgtggaccaaaaagccttttatcgtgagaaaattaaaacactgctgaagcaacgc
gatgccgtgttagtcgctcactattataccgaccctgaaattcaggctttggccgaagag
accggcggctgtgttgctgactccctggagatggcgcgatttggtaacaaccactccgct
tcaactctgctggtcgctggcgttcgttttatgggtgaaacggctaaaatactcaatccc
gaaaagcaagtattgatgccaaccctcaatgctgaatgttcgctggatttaggctgtccg
gctgatgaatttgccgcattctgcgacagccatcctgaccgcaccgtcgtggtgtatgcc
aatacctcagcggcggtcaaagcccgggctgattgggtggtcacttccagtatcgcggtt
gagttaatcgaacatctcgatagcctgggcgagaaaataatctgggcaccggataggcat
cttggaaactacgtacaaaaaaggagtggtgccgatgtgctgtgctggcagggggcttgc
atcgtccatgacgagtttaaaacccaagcactggctcaaatgaaagcattacatcccgat
gccgcggtgttggttcacccggagtcgccacaagctgttgtcgatatggcggatgcggta
ggttcaaccagtcagttgatcatggcggcaaaaacattgctccagaaaaaactgatcgtc
gcaacggatcggggcattttctataaaatgcagcaggcttgtccggataaagagttattc
gaagcgcccactgctggtgaaggtgcaacatgccgaagctgtgcgcattgtccgtggatg
gcgatgaatggtcttaaagcgatagctgaggggctggagcagggtggagtgatgcatgag
atacatgttgatgaacaattgcgtcagcaggcgctgataccgctaaatcgcatgttgggt
tttgctaatgagttgaagctacagagcaaaggcaatgcataa

DBGET integrated database retrieval system