KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1310Help
Entry
YE105_C1310       CDS       T01480                                 

Definition
quinolinate synthetase
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YE105_C1310
Enzymes [BR:yep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     YE105_C1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564761..1565822
Genome map
AA seq 353 aa AA seqDB search
MSETFDVNAAIYPFPARPVPLDVDQKAFYREKIKTLLKQRDAVLVAHYYTDPEIQALAEE
TGGCVADSLEMARFGNNHSASTLLVAGVRFMGETAKILNPEKQVLMPTLNAECSLDLGCP
ADEFAAFCDSHPDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGEKIIWAPDRH
LGNYVQKRSGADVLCWQGACIVHDEFKTQALAQMKALHPDAAVLVHPESPQAVVDMADAV
GSTSQLIMAAKTLLQKKLIVATDRGIFYKMQQACPDKELFEAPTAGEGATCRSCAHCPWM
AMNGLKAIAEGLEQGGVMHEIHVDEQLRQQALIPLNRMLGFANELKLQSKGNA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacttttgatgtgaatgcagcgatttatcctttccctgcgcggcctgtcccg
ctggatgtggaccaaaaagccttttatcgtgagaaaattaaaacactgctgaagcaacgc
gatgccgtgttagtcgctcactattataccgaccctgaaattcaggctttggccgaagag
accggcggctgtgttgctgactccctggagatggcgcgatttggtaacaaccactccgct
tcaactctgctggtcgctggcgttcgttttatgggtgaaacggctaaaatactcaatccc
gaaaagcaagtattgatgccaaccctcaatgctgaatgttcgctggatttaggctgtccg
gctgatgaatttgccgcattctgcgacagccatcctgaccgcaccgtcgtggtgtatgcc
aatacctcagcggcggtcaaagcccgggctgattgggtggtcacttccagtatcgcggtt
gagttaatcgaacatctcgatagcctgggcgagaaaataatctgggcaccggataggcat
cttggaaactacgtacaaaaaaggagtggtgccgatgtgctgtgctggcagggggcttgc
atcgtccatgacgagtttaaaacccaagcactggctcaaatgaaagcattacatcccgat
gccgcggtgttggttcacccggagtcgccacaagctgttgtcgatatggcggatgcggta
ggttcaaccagtcagttgatcatggcggcaaaaacattgctccagaaaaaactgatcgtc
gcaacggatcggggcattttctataaaatgcagcaggcttgtccggataaagagttattc
gaagcgcccactgctggtgaaggtgcaacatgccgaagctgtgcgcattgtccgtggatg
gcgatgaatggtcttaaagcgatagctgaggggctggagcagggtggagtgatgcatgag
atacatgttgatgaacaattgcgtcagcaggcgctgataccgctaaatcgcatgttgggt
tttgctaatgagttgaagctacagagcaaaggcaatgcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system