KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1314Help
Entry
YE105_C1314       CDS       T01480                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00010  Glycolysis / Gluconeogenesis
yep00260  Glycine, serine and threonine metabolism
yep00680  Methane metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
yep01230  Biosynthesis of amino acids
Module
yep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yep_M00002  Glycolysis, core module involving three-carbon compounds
yep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C1314
  Energy metabolism
   00680 Methane metabolism
    YE105_C1314
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C1314
Enzymes [BR:yep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YE105_C1314
Membrane trafficking [BR:yep04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YE105_C1314
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YE105_C1314
  Exosomal proteins of melanoma cells
   YE105_C1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADZ41810
Position
complement(1569354..1570106)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWSILDELDQAWLPTEKTWKLNERHYGALQGLDKSETAAKYGDEQVKLWRRGFA
ITPPALDKSDERFPGHDPRYAKLTDAELPTTESLALTIDRVIPYWEEVIKPRIASGERVI
IAAHGNSLRALVKYLDNLNEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaagctggttctggtacgtcacggcgaaagtcaatggaacaacgaaaac
cgtttcacaggttggtatgacgttgatttgtctgagaaaggccgtaccgaagcaaaagca
gctggcaagctgttgaaagatgaaggttttacttttgatttcgcctacacctcagtatta
aaacgcgctatccataccttgtggagcatcctggacgaactggatcaggcctggctccca
acggaaaaaacctggaaactgaatgagcgacattacggcgcattgcaaggtttggataaa
tctgaaactgcggctaaatacggtgatgagcaagttaaactgtggcgtcgcggctttgcc
atcacccctccagcactggataaaagtgatgagcgcttccctggccatgacccacgttat
gcaaaattaaccgatgcagagctgccaaccactgaaagcctggctctgactatcgatcgc
gttatcccttactgggaagaagtgatcaaaccacgcatcgccagtggcgagcgcgttatc
atcgctgctcacggtaactctttgcgtgcactggttaaatatctggataatctgaacgaa
gaagaaattcttgagctgaatatcccaacaggtgtgccattagtgtatgagtttgacgaa
aacttcaaaccaatcaaacactactatttgggcaacgctgatgaaatcgcggctaaagct
gctgcggttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system