KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1314Help
Entry
YE105_C1314       CDS       T01480                                 

Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C1314
   01230 Biosynthesis of amino acids
    YE105_C1314
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C1314
  Energy metabolism
   00680 Methane metabolism
    YE105_C1314
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C1314
Enzymes [BR:yep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YE105_C1314
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YE105_C1314
  Exosomal proteins of melanoma cells
   YE105_C1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1569354..1570106)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWSILDELDQAWLPTEKTWKLNERHYGALQGLDKSETAAKYGDEQVKLWRRGFA
ITPPALDKSDERFPGHDPRYAKLTDAELPTTESLALTIDRVIPYWEEVIKPRIASGERVI
IAAHGNSLRALVKYLDNLNEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaagctggttctggtacgtcacggcgaaagtcaatggaacaacgaaaac
cgtttcacaggttggtatgacgttgatttgtctgagaaaggccgtaccgaagcaaaagca
gctggcaagctgttgaaagatgaaggttttacttttgatttcgcctacacctcagtatta
aaacgcgctatccataccttgtggagcatcctggacgaactggatcaggcctggctccca
acggaaaaaacctggaaactgaatgagcgacattacggcgcattgcaaggtttggataaa
tctgaaactgcggctaaatacggtgatgagcaagttaaactgtggcgtcgcggctttgcc
atcacccctccagcactggataaaagtgatgagcgcttccctggccatgacccacgttat
gcaaaattaaccgatgcagagctgccaaccactgaaagcctggctctgactatcgatcgc
gttatcccttactgggaagaagtgatcaaaccacgcatcgccagtggcgagcgcgttatc
atcgctgctcacggtaactctttgcgtgcactggttaaatatctggataatctgaacgaa
gaagaaattcttgagctgaatatcccaacaggtgtgccattagtgtatgagtttgacgaa
aacttcaaaccaatcaaacactactatttgggcaacgctgatgaaatcgcggctaaagct
gctgcggttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system