KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1462Help
Entry
YE105_C1462       CDS       T01480                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YE105_C1462
Enzymes [BR:yep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YE105_C1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1721778..1722440
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHEALLARGLETPLRKQELDAETRKTRIQEHMTQVMQLLNLDLSDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctgagtaaagaagctgagctggttcatgaagcactgctggcccgtggcctt
gaaaccccattgcgcaaacaagaattagatgccgaaacgcgcaagacccggattcaggaa
catatgacgcaagtcatgcaattgttgaatcttgatttatctgacgatagcctggccgat
acaccaagacgcattgccaaaatgtatgttgatgagattttctctggattggattatgag
aatttccccaaaattaccctgatcgaaaataaaatgaaggtcgatgaaatggtaacggtg
cgagatatcaccctgaccagtacctgcgaacatcattttgtgacgattgatggtaaagcg
acagtggcctatatcccgaaagacagtgtgattggtttatccaaaattaaccgtatcgtg
cagtttttcgcccagcgcccacaagtacaagagcgactcacacagcaaattctgttggcg
ttgcagaccttgttagggacaaataatgtcgctgtctccatcgatgcagtacattattgt
gtgaaagctcgcgggatccgcgatgcgaccagtgcgaccaccactacatcattgggcggg
ttgttcaaatccagccagaatactcgtcaggagtttctgcgtgctgttcgtcacaacggc
taa

DBGET integrated database retrieval system