KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1502Help
Entry
YE105_C1502       CDS       T01480                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YE105_C1502
   00052 Galactose metabolism
    YE105_C1502
   00500 Starch and sucrose metabolism
    YE105_C1502
   00520 Amino sugar and nucleotide sugar metabolism
    YE105_C1502
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YE105_C1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1772520..1773410
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKSICPPDVTIMQVRQGHAKGLGHAVLCAQPM
VGDNPFIVLLPDVLLDDSTADLSKENLASMIKRFEETGRSQIMVEPVPQADVSKYGIADC
GHVDLAPGESTLMTAVVEKPSVEDAPSNLAVVGRYVLSKDIWPLLKKTPRGAGDEIQLTD
AIAMLMEQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHSTEGENFTAWLKQQID
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttgaaagcagtcattcctgttgccgggcttggcacccgcatgttgccagcg
accaaggcgattccgaaagaaatgctgccagtagtcgataagcccctgattcaatatatt
gttaatgaatgtgttgctgccggggtcaaagagatcgtactggtgagccactcttccaag
aacgcaatagaaaaccattttgatacttcatttgaacttgaagcggccttggagtctcgg
gttaagcggcagttattaaaagagattaagagtatttgcccgccagatgtcactatcatg
caagtgcgtcaaggtcacgccaaagggttagggcatgcggtactgtgtgctcaaccgatg
gtgggtgacaatccttttattgtattgctgccagatgtattactcgatgattcaacagct
gatttgtcgaaagagaatcttgccagcatgattaaacgttttgaagaaaccgggcggagc
cagatcatggtggaaccggtacctcaagcagatgtttccaagtacggtattgctgattgc
ggccatgtcgatttagcgccgggtgaaagtactcttatgactgcggtggtagagaagcct
tctgtggaggacgcgccgtctaatcttgctgtggttgggcgctacgttttgtctaaagat
atttggccgttgctgaagaaaactccgcgcggtgctggtgatgaaattcaactaactgat
gctatcgcgatgttaatggagcaagagccggttgaagctttccatatgacgggtaaatct
catgattgcggagataaattaggctatatgaaagcctttgtgacttatggtgttcgtcat
agtactgaaggtgaaaattttacagcttggctgaaacagcaaattgactaa

DBGET integrated database retrieval system